DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and Snx15

DIOPT Version :10

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001019923.1 Gene:Snx15 / 293691 RGDID:1305803 Length:338 Species:Rattus norvegicus


Alignment Length:168 Identity:38/168 - (22%)
Similarity:65/168 - (38%) Gaps:43/168 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 YEVMEERAR---FTAYKLRVE-----NPETNDYWLVMRRYTDFVRLNSKLKQAFPNLTLML---- 281
            |.|.:.|..   :|.||:..:     :||.....:|.:||:||.:|:..|.....||...|    
  Rat    14 YTVSDPRTHPKGYTEYKVTAQFISKKDPEDIKEVVVWKRYSDFRKLHGDLAYTHRNLFRRLEEFP 78

  Fly   282 --PRKKLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFF------------------ 326
              ||.::|| .|.|..::.|.:|.:..:...:....|.....::|||                  
  Rat    79 AFPRAQVFG-RFEASVIEERRKGAEDLLRFTVPIPALNNSPQLKEFFRGGEVTRPSEVSRDLQIL 142

  Fly   327 ---CLDEPPSYSESMEECRAI--FEAQEETIEHLKLQI 359
               .:..|||     :|.|.:  ..|:....|.|::.:
  Rat   143 PPPLIPTPPS-----DEARLLQPLPAERRGQEELEVPV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 30/134 (22%)
Snx15NP_001019923.1 PX_domain 10..127 CDD:470617 30/113 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..155 3/25 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..270
MIT_SNX15 268..338 CDD:239140
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.