DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and RPS6KC1

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_036556.2 Gene:RPS6KC1 / 26750 HGNCID:10439 Length:1066 Species:Homo sapiens


Alignment Length:208 Identity:50/208 - (24%)
Similarity:81/208 - (38%) Gaps:44/208 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 YEVMEERAR---FTAYKL--RV---ENPETNDYWLVMRRYTDFVRLNSKLKQAFPNL----TLML 281
            |.|.|.:..   :|.||:  ||   .|||.....:|.:||:||.:|:.:|.|...||    .|..
Human    15 YTVTEPQRHPRGYTVYKVTARVVSRRNPEDVQEIIVWKRYSDFKKLHKELWQIHKNLFRHSELFP 79

  Fly   282 PRKK--LFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFF----------CLDEPPSY 334
            |..|  :|| .|:...::.|.|..:..:........|...|.:.:||          .:....::
Human    80 PFAKGIVFG-RFDETVIEERRQCAEDLLQFSANIPALYNSKQLEDFFKGGIINDSSELIGPAEAH 143

  Fly   335 SESM----EECRAIFEAQEETIEHLKLQIRNKNDLILSLQQKLREEMNEKEQLREAMKNMELNCS 395
            |:|:    .||.....:.:..:..|.:.:    |.:..|...:....|      ..::...||.|
Human   144 SDSLIDTFPECSTEGFSSDSDLVSLTVDV----DSLAELDDGMASNQN------SPIRTFGLNLS 198

  Fly   396 HCSS-----ASDS 403
            ..||     ||||
Human   199 SDSSALGAVASDS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 33/123 (27%)
RPS6KC1NP_036556.2 PX_RPK118_like 11..128 CDD:132820 33/113 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..228 4/5 (80%)
MIT_SNX15 238..312 CDD:239140
PKc_like 335..>421 CDD:304357
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 441..509
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 553..596
S_TKc <875..1056 CDD:214567
STKc_RPK118_like <879..1056 CDD:270728
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.