DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and Snx14

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001346887.2 Gene:Snx14 / 244962 MGIID:2155664 Length:946 Species:Mus musculus


Alignment Length:438 Identity:96/438 - (21%)
Similarity:159/438 - (36%) Gaps:147/438 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KKSLLKTGNSVCGLDKRSQFREQK-LLGRKCHSSPDLRQIGKYQ-----------NNSLLRSKSE 97
            |.|:||.        :..|.|||: ||.|..:.   |:|.|...           |:.:||.:..
Mouse   329 KPSVLKL--------ELKQIREQQDLLFRFMNF---LKQEGAVHVLQFCLTVEEFNDRILRPELS 382

  Fly    98 GDVSLILASN-------------------------------SGAPLTVANAKSEVCLQRISSH-- 129
            .|..|.|...                               .|..:.|...::..||.....|  
Mouse   383 NDEMLSLHEELQKIYKTYCLDESIDKIRFDPFIVEEIQRIAEGPYIDVVKLQTMRCLFEAYEHVL 447

  Fly   130 SYEQSPRTPI--NKSE----MLGGARSHRDLTQSSYGNQAGGHSVDLESRSRTPRRMSECSLGYS 188
            |..::..||:  :..|    :|.||.|.   |::|..|:.   |:.|:....|.:|..  |.|.|
Mouse   448 SLLENVFTPMFCHSDEYFRQLLRGAESP---TRNSKFNRG---SLSLDDFRSTQKRGE--SFGIS 504

  Fly   189 QSSSRHTGSNSMFASQMTLSSGSVVP-----------------------PVD----PNA------ 220
            :..|:..|   :|.|  |...|:|:|                       ||:    ||.      
Mouse   505 RIGSKIKG---VFKS--TTMEGAVLPNYGVAEGEDDFIEEGIVVMEDDSPVEAVSTPNTPRNLAA 564

  Fly   221 -VLRVPIIGY------EVMEERARFTAYKLRVENPETN------DYWLVMRRYTDFVRLNSKLKQ 272
             .:.:|.:.:      |..|::.|...:.:.||..:..      ::|.|.|||.:|..|.|||.:
Mouse   565 WKISIPYVDFFEDPSSERKEKKERIPVFCIDVERNDRRAVGHEPEHWSVYRRYLEFYVLESKLTE 629

  Fly   273 ---AFPNLTLMLPRKKLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFFCLDEPPSY 334
               .||:  ..||.|::.|.. |..||.::.:..|.::..::...||...:|:.:|.    .|:.
Mouse   630 FHGTFPD--AQLPSKRIIGPK-NYEFLKSKREEFQEYLQKLVQHPELSNSQLLADFL----SPNG 687

  Fly   335 SESMEECRAIFEAQEETIEHLKLQIRNKNDLILSLQQKLREEMNEKEQ 382
            .|:            :.::.:...: |...:|.|:..||   |.||.|
Mouse   688 GET------------QFLDKILPDV-NLGKIIKSVPGKL---MKEKGQ 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 31/131 (24%)
Snx14NP_001346887.2 PXA 130..299 CDD:308031
RGS_SNX14 340..466 CDD:188677 24/128 (19%)
PX_SNX14 564..686 CDD:132787 30/128 (23%)
Nexin_C 807..911 CDD:337134
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.