DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and SNX13

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001337791.1 Gene:SNX13 / 23161 HGNCID:21335 Length:968 Species:Homo sapiens


Alignment Length:377 Identity:81/377 - (21%)
Similarity:151/377 - (40%) Gaps:75/377 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SVCGLDKRSQFREQKLLGRKCHSSPDLRQIGKYQNN---SLLRSKSEGDVSLILASNSGAPLTVA 115
            :|.|....:|.:.:.||.|        ::.||:|.|   .|||:.:.|.....|:..:...:|| 
Human   405 TVEGYRVTAQQQLEVLLSR--------QRDGKHQTNQTKGLLRAAAVGIYEQYLSEKASPRVTV- 460

  Fly   116 NAKSEVCLQRISSHSYEQSPRTP-----INKSE---MLGGARSHRDLTQSSY------------- 159
               .:..:.:::.....:.| ||     |.:..   ||...|.:....|::.             
Human   461 ---DDYLVAKLADTLNHEDP-TPEIFDDIQRKVYELMLRDERFYPSFRQNALYVRMLAELDMLKD 521

  Fly   160 ----GNQAGGHSVDLESRSRTPRRMSECSLGYSQSSSRHTGSNSMFASQMTLSSGSVVPPVDPNA 220
                |:..|    |.||.:.:|..    |:..|.....:..|:........:|. :|....||.|
Human   522 PSFRGSDDG----DGESFNGSPTG----SINLSLDDLSNVSSDDSVQLHAYISD-TVYADYDPYA 577

  Fly   221 VLRVPIIGYEVMEERARFTAYKLRV--ENPETNDYWLVMRRYTDFVRLNSKLKQAFPNLT--LML 281
            |..|      ..:....:..|.:.|  .|..:.:.|...|||:||...:.::.:.|.:|:  |.|
Human   578 VAGV------CNDHGKTYALYAITVHRRNLNSEEMWKTYRRYSDFHDFHMRITEQFESLSSILKL 636

  Fly   282 PRKKLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREF-FCLDEPPSYSESMEECRAIF 345
            |.||.| :|.:..||:.|.:.|..::..::|.|.::....:..: :...|..:||:.    :..|
Human   637 PGKKTF-NNMDRDFLEKRKKDLNAYLQLLLAPEMMKASPALAHYVYDFLENKAYSKG----KGDF 696

  Fly   346 EAQEET-IEHLKLQIRNKNDLILSLQQKLREEMNE--------KEQLREAMK 388
            ..:.:| :..|:..:||.::.:.||...|.|.|.:        .|:|.:.:|
Human   697 ARKMDTFVNPLRNSMRNVSNAVKSLPDSLAEGMTKMSDNMGKMSERLGQDIK 748

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 27/114 (24%)
SNX13NP_001337791.1 PXA 97..284 CDD:214611
RGS_SNX13 377..511 CDD:188674 25/118 (21%)
PX_SNX13 557..687 CDD:132783 32/137 (23%)
Nexin_C 803..911 CDD:312222
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.