DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and Sgk3

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001362972.1 Gene:Sgk3 / 171498 RGDID:620242 Length:496 Species:Rattus norvegicus


Alignment Length:160 Identity:48/160 - (30%)
Similarity:74/160 - (46%) Gaps:33/160 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 ECSLGYSQSSSRHTGSNSMFASQMTLSSGSV-VPPVDPNAVLRVPIIGYEVMEERARFTAYKLRV 245
            :|::.|.:|..                  || :|..|            |..|::.|||.||:.|
  Rat     4 DCTMDYKESCP------------------SVSIPSSD------------EHREKKKRFTVYKVLV 38

  Fly   246 ENPETNDYWLVMRRYTDFVRLNSKLKQAFPNLTLMLPRKKLFGDNFNAVFLDNRVQGLQIFVNSV 310
            ....:.  |.|.|||.:|.:|.:.||:.||.:.|.:|.|::|||||:..|:..|..||..|:.::
  Rat    39 SVGRSE--WFVFRRYAEFDKLYNSLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNL 101

  Fly   311 MAKEELRKCKLVREFFCLDEPPSYSESMEE 340
            :...||.....||.|..:|.|...|:..|:
  Rat   102 VRYPELYNHPDVRAFLQMDSPRHQSDPSED 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 37/109 (34%)
Sgk3NP_001362972.1 PX_CISK 12..120 CDD:132780 42/139 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..157 3/11 (27%)
STKc_SGK3 165..490 CDD:270755
Nuclear localization signal. /evidence=ECO:0000250 195..205
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.