DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and Kif16b

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_036014693.1 Gene:Kif16b / 16558 MGIID:1098240 Length:1908 Species:Mus musculus


Alignment Length:487 Identity:102/487 - (20%)
Similarity:164/487 - (33%) Gaps:183/487 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KSLLKTGNSVCGLDK-----------RSQFREQKLLGRKCHSSPDLRQIGKYQNNSLLRSKSEGD 99
            |:||..||.:..||.           :::.|.|:|.....:...:.:.|.|.|..:|   :.|| 
Mouse   418 KTLLAQGNQIALLDSPTALSMEEKLHQNEARVQELTKEWTNKWNETQNILKEQTLAL---RKEG- 478

  Fly   100 VSLILASNSGAPLTVANAKSEVCLQRISSHSYEQSPRTPINKSEMLGGARSHRDLTQSSYGNQAG 164
            :.::|  :|..|..:......:....|..|..|  .:|.:.:.:    |.:.:|:..        
Mouse   479 IGVVL--DSELPHLIGIDDDLLSTGIILYHLKE--GQTYVGRED----ASTEQDIVL-------- 527

  Fly   165 GHSVDLESR-----------SRTPRRMSECSLGYSQ----------------------------- 189
             |.:||||.           :..|.|.|:||:...|                             
Mouse   528 -HGLDLESEHCVFENAGGTVTLIPLRGSQCSVNGVQIVDATQLNQGAVILLGRTNMFRFNHPKEA 591

  Fly   190 ---SSSRHTGSNSMFASQMT-LSSG----SVVPPVDPNAVLRVPIIG------------------ 228
               ...|.:|..|.|:..|| ||..    |.|...:|..   .||.|                  
Mouse   592 AKLREKRKSGLLSSFSLSMTDLSKSCENLSAVMLYNPGL---FPIKGPICLRLEFERQQREELEK 653

  Fly   229 -------YEVMEERARFTAYKLRVENPETNDYWLVMRRYTDFVR----------------LNSKL 270
                   .|.|||:.:....:|.....|..    ..|:.|:.|:                :.:||
Mouse   654 LESKRKLIEEMEEKQKSDKAELERMQQEVE----TRRKETEIVQRQIRKQEESLKRRSFHIENKL 714

  Fly   271 KQAFPNLTLMLPRKKLFGDNFNAVFLDNRV---QGLQ---------IFVNSVMAKEELRK----- 318
            |.       :|..|:.|.        :.|:   |||:         :|    ..:|||||     
Mouse   715 KD-------LLAEKERFE--------EERLREQQGLEQQRRQEEESLF----RIREELRKLQELN 760

  Fly   319 ----CKLVREFFCLD----EPPSYSESME-ECRAIFEAQEETIE---HLKLQIRNKND----LIL 367
                .:.|:.|..||    |..:.|..:. |.|.:.|.::|.::   ||:.|:|.:.|    |..
Mouse   761 SHEQAEKVQIFQELDRLHQEQNAQSAKLRLEKRRLEEEEKEQVQRVAHLEEQLRKRQDTAPLLCP 825

  Fly   368 SLQQKLREEMNEKEQLREAM---KNMELNCSH 396
            ...|:.:||..|.|.:|||:   |.|.....|
Mouse   826 GEAQRAQEEKRELESIREALLQAKEMRAGGDH 857

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 30/171 (18%)
Kif16bXP_036014693.1 KISc_KIF1A_KIF1B 51..399 CDD:276816
Kinesin_assoc 398..510 CDD:406567 22/99 (22%)
FHA 512..577 CDD:395400 14/77 (18%)
SbcC <644..1081 CDD:223496 52/237 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.