DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and SNX20

DIOPT Version :10

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_878274.1 Gene:SNX20 / 124460 HGNCID:30390 Length:316 Species:Homo sapiens


Alignment Length:176 Identity:45/176 - (25%)
Similarity:74/176 - (42%) Gaps:40/176 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 MEER--ARFTAYKLRVENPET--NDYWLVMRRYTDFVRLNSKLKQAFPN--LTLMLPRKKLFGDN 290
            :|||  ::|..|::.|....:  |:..::.|||:||.:|...|.:.|..  ..:..|||.|.| |
Human    85 IEERKVSKFVVYQIIVIQTGSFDNNKAVLERRYSDFAKLQKALLKTFREEIEDVEFPRKHLTG-N 148

  Fly   291 FNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFFCLDEPPSYSESMEECRAIFEAQEETIEHL 355
            |....:..|.:.||.::..:.|   :|..:..|||......|...|:....||     .:....|
Human   149 FAEEMICERRRALQEYLGLLYA---IRCVRRSREFLDFLTRPELREAFGCLRA-----GQYPRAL 205

  Fly   356 KLQIRNKNDLILSLQQKLREEMNEKEQLREAMKNMELNCSHCSSAS 401
            :|.:|     :|.||:||                    .:||.:|:
Human   206 ELLLR-----VLPLQEKL--------------------TAHCPAAA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 30/102 (29%)
SNX20NP_878274.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..54
PX_SNX20 76..189 CDD:132833 31/107 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.