DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and Snx25

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001359271.1 Gene:Snx25 / 102141 MGIID:2142610 Length:986 Species:Mus musculus


Alignment Length:325 Identity:69/325 - (21%)
Similarity:109/325 - (33%) Gaps:100/325 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SKSEGDVSLILASNSGAPLTVANAKSEVCLQRISSHSYEQSPRTPI-NKSEMLGGARSHRDLTQS 157
            ||.:.|||.:|.........|::     ..:::.....|:.|...: ::.:.||.          
Mouse   519 SKIQADVSEVLRERYYPSFLVSD-----LYEKLMREEEEEEPDAQLASEKDELGS---------- 568

  Fly   158 SYGNQAGGHSVDLESRSRTP--------RRMSECSLGYSQSSSRHTGSNSMFASQMTLSSGSVVP 214
              |.:||..:|:..|....|        |.::| .|.|.:.:               |||....|
Mouse   569 --GGEAGEEAVEGTSGVSDPASFAVIKLRELNE-KLEYKRQA---------------LSSIQNAP 615

  Fly   215 PVDPNAV---------------------------------LRVPIIGYEVMEERA-RFTAYKLRV 245
            ..|...:                                 .|..|...||.||.. :...|.:||
Mouse   616 KPDKKIISKLKDEILLIEKECTALQLHMARTDWWCENLGLWRASITSAEVTEENGEQMPCYFVRV 680

  Fly   246 ENPETNDY----WLVMRRYTDFVRLNSKLKQAFPNL-TLMLPR-KKLFGDNFNAVFLDNRVQGLQ 304
            ...|....    |.|.||.::|..|:.||.:..|:| .:.||. .||...:.:..||......|.
Mouse   681 NLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDHKFLGKSRNQLN 745

  Fly   305 IFVNSVMAKEELRKCKLVREFFCLDEPPSY---------------SESMEEC-RAIFEAQEETIE 353
            .|:.::::.|.|.:.:.:..|  |...|.|               |..:|:. |..|..|||.||
Mouse   746 AFLQNLLSDERLFQSEALYAF--LSPSPDYLKVIDVQGKKTSFSLSSFLEKLPRDFFSHQEEEIE 808

  Fly   354  353
            Mouse   809  808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 31/149 (21%)
Snx25NP_001359271.1 PXA 148..303 CDD:366970
RGS 437..545 CDD:383028 7/30 (23%)
End3 <558..645 CDD:372297 17/114 (15%)
PX_SNX25 648..770 CDD:132788 32/123 (26%)
Nexin_C 847..950 CDD:370015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.