DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx16 and Snx21

DIOPT Version :9

Sequence 1:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_030102304.1 Gene:Snx21 / 101113 MGIID:1917729 Length:372 Species:Mus musculus


Alignment Length:178 Identity:50/178 - (28%)
Similarity:76/178 - (42%) Gaps:20/178 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 GNQAGGHSVDLESRSRTPRRMSECSLGYSQSSSRHTGSNSMFASQMTL---SSGSVVPPVDPNAV 221
            |:.|.|...:   ||..|.......|...|.......|.:....|..|   :|.:||.  ||.: 
Mouse    78 GDGASGEDAE---RSPPPDGQRSSQLLARQLQDFWKKSRNTLVPQRLLFEVTSANVVK--DPPS- 136

  Fly   222 LRVPIIGYEVMEERARFTAYKLRVENPETNDYW--LVMRRYTDFVRLNSKLKQAF--PNLTLMLP 282
               ..:.:.:.||...:|   |.|..|...|..  .:.|||:||.||:..|::.|  |...:..|
Mouse   137 ---KYVAWVISEEPQLYT---LAVMGPGPPDRQPAQISRRYSDFERLHRNLQRQFRGPMSAISFP 195

  Fly   283 RKKLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFFCLDE 330
            ||:| ..||.|..:..|.:..:.|:..:.|..|||:...:::||.|.|
Mouse   196 RKRL-RRNFTAETIARRSRAFEQFLGHLQAVPELRQAPDLQDFFVLPE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 32/113 (28%)
Snx21XP_030102304.1 PX_domain 121..241 CDD:383026 38/129 (29%)
TPR_12 243..312 CDD:315987 50/178 (28%)
TPR repeat 243..267 CDD:276809 50/178 (28%)
TPR repeat 280..311 CDD:276809
TPR repeat 325..352 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.