DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and sh3glb1a

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_009295790.1 Gene:sh3glb1a / 792229 ZFINID:ZDB-GENE-050417-89 Length:398 Species:Danio rerio


Alignment Length:241 Identity:49/241 - (20%)
Similarity:78/241 - (32%) Gaps:83/241 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KKATNASIERDLPAVGVLGMGRITGSSSIETLVRVGIEKEHGLSPDSKMVVLHDFTPCVDDELEV 78
            ::.|.|  |:||.    :........:.|..|:..||...|.          |... |::|.:|.
Zfish   221 EEVTTA--EQDLK----MTQSEFDRQAEITRLLLEGISSTHA----------HHLR-CLNDFVEA 268

  Fly    79 KRGQLVNILYRENDWVYVIGQDSRQEGFIPFSYCAPCNTQLADLAVKKKLPREQCPEQPIEENIP 143
            :                             .:|.|.|...:.||  :|:|           .|.|
Zfish   269 Q-----------------------------MTYYAQCYQYMVDL--QKQL-----------GNFP 291

  Fly   144 LLGTDNKLDVLCDETLNPGSANSIENTLLVEPECTPFVKEPSG---------------RCIVLYT 193
            ...|.|.    ...|.:.|:..|:.    :.|..||.....|.               :..|||.
Zfish   292 SAFTSNN----NQSTASGGAGVSVP----ILPLSTPLPSTTSNTSSGFTEMQNFSGSRKARVLYD 348

  Fly   194 FIARDENDLSVERGEFVTVLNREDPDWFWIMRSDG-QEGFVPASFI 238
            :.|...|:||:...|.:.|.:....|..|:|...| |:|.||.:::
Zfish   349 YDAAGSNELSLLADEVIMVSSVPGMDSDWLMGERGSQKGKVPITYL 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 4/49 (8%)
SH3 184..238 CDD:214620 18/69 (26%)
SH3 293..346 CDD:212690
sh3glb1aXP_009295790.1 BAR 21..287 CDD:299863 20/113 (18%)
SH3_Endophilin_B1 338..398 CDD:212878 17/57 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583885
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.