DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and SH3GL2

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_011516307.1 Gene:SH3GL2 / 6456 HGNCID:10831 Length:386 Species:Homo sapiens


Alignment Length:197 Identity:46/197 - (23%)
Similarity:74/197 - (37%) Gaps:33/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EKEHGLSPDSKM-VVLHDFTPCVDDELEVKRGQLVNILYRENDWVYVIGQDSRQEGFI--PFSYC 112
            :|..|..||.:: ..|..|    |:..|:....:.|:|  |.|    |.|.|:....:  ...|.
Human   206 KKRQGKIPDEELRQALEKF----DESKEIAESSMFNLL--EMD----IEQVSQLSALVQAQLEYH 260

  Fly   113 APCNTQLADLAVKKKLPREQCPEQPIEENIPLLGTDNKLDVLCDETLNPGSANSIENTLLVEPEC 177
            ......|..:.|:.:....|...||..|..|  .....|:....::..|....|...|       
Human   261 KQAVQILQQVTVRLEERIRQASSQPRREYQP--KPRMSLEFPTGDSTQPNGGLSHTGT------- 316

  Fly   178 TPFVKEPSG------RCIVLYTFIARDENDLSVERGEFVTVLNREDPDWFWIMRSDGQEGFVPAS 236
                .:|||      .|..||.|...:|.:|..:.|:.:|:.|:.|.:|:..| ..|..||.|.:
Human   317 ----PKPSGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGM-LHGHSGFFPIN 376

  Fly   237 FI 238
            ::
Human   377 YV 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 11/52 (21%)
SH3 184..238 CDD:214620 19/59 (32%)
SH3 293..346 CDD:212690
SH3GL2XP_011516307.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149746
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.