Sequence 1: | NP_611251.2 | Gene: | Dlish / 37014 | FlyBaseID: | FBgn0034264 | Length: | 355 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003016.1 | Gene: | SH3GL1 / 6455 | HGNCID: | 10830 | Length: | 368 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 51/204 - (25%) |
---|---|---|---|
Similarity: | 79/204 - (38%) | Gaps: | 31/204 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 EKEHGLSPDSKM-VVLHDFTPCVDDELEVKRGQLVNILYRENDWVYVIGQDSRQEGFI--PFSYC 112
Fly 113 APCNTQLADLAVKKKLPREQCPEQPIEENIPLLGTDNKLDVLCDETLNPG-------------SA 164
Fly 165 NSIENTLLVEPECTPFVKEPSGRCIVLYTFIARDENDLSVERGEFVTVLNREDPDWFWIMRSDGQ 229
Fly 230 EGFVPASFI 238 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dlish | NP_611251.2 | SH3 | 61..111 | CDD:212690 | 11/52 (21%) |
SH3 | 184..238 | CDD:214620 | 20/53 (38%) | ||
SH3 | 293..346 | CDD:212690 | |||
SH3GL1 | NP_003016.1 | Membrane-binding amphipathic helix. /evidence=ECO:0000250 | 1..21 | ||
BAR_Endophilin_A | 25..247 | CDD:153276 | 21/84 (25%) | ||
Required for dimerization upon membrane association. /evidence=ECO:0000250 | 60..87 | ||||
Interaction with ARC. /evidence=ECO:0000250 | 218..254 | 7/35 (20%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 244..308 | 10/65 (15%) | |||
SH3_Endophilin_A | 309..363 | CDD:212737 | 20/55 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165149741 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |