DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and SH3GL1

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_003016.1 Gene:SH3GL1 / 6455 HGNCID:10830 Length:368 Species:Homo sapiens


Alignment Length:204 Identity:51/204 - (25%)
Similarity:79/204 - (38%) Gaps:31/204 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EKEHGLSPDSKM-VVLHDFTPCVDDELEVKRGQLVNILYRENDWVYVIGQDSRQEGFI--PFSYC 112
            :|..|..||.:: ..|..|    ::..||....:.|:|  |.|    |.|.|:....:  ...|.
Human   172 KKRQGKIPDEELRQALEKF----EESKEVAETSMHNLL--ETD----IEQVSQLSALVDAQLDYH 226

  Fly   113 APCNTQLADLAVKKKLPREQCPEQPIEENIPLLGTDNKLDVLCDETLNPG-------------SA 164
            ......|.:||.|.|....:...:|..|..|  ......|:...|..|.|             |.
Human   227 RQAVQILDELAEKLKRRMREASSRPKREYKP--KPREPFDLGEPEQSNGGFPCTTAPKIAASSSF 289

  Fly   165 NSIENTLLVEPECTPFVKEPSGRCIVLYTFIARDENDLSVERGEFVTVLNREDPDWFWIMRSDGQ 229
            .|.:..:.......|.:.:||  |..||.|...::.:|....|:.:|:.|:.|.:|:..| .|||
Human   290 RSSDKPIRTPSRSMPPLDQPS--CKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGM-LDGQ 351

  Fly   230 EGFVPASFI 238
            .||.|.|::
Human   352 SGFFPLSYV 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 11/52 (21%)
SH3 184..238 CDD:214620 20/53 (38%)
SH3 293..346 CDD:212690
SH3GL1NP_003016.1 Membrane-binding amphipathic helix. /evidence=ECO:0000250 1..21
BAR_Endophilin_A 25..247 CDD:153276 21/84 (25%)
Required for dimerization upon membrane association. /evidence=ECO:0000250 60..87
Interaction with ARC. /evidence=ECO:0000250 218..254 7/35 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..308 10/65 (15%)
SH3_Endophilin_A 309..363 CDD:212737 20/55 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149741
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.