Sequence 1: | NP_611251.2 | Gene: | Dlish / 37014 | FlyBaseID: | FBgn0034264 | Length: | 355 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_067481.2 | Gene: | Sh3rf1 / 59009 | MGIID: | 1913066 | Length: | 891 | Species: | Mus musculus |
Alignment Length: | 208 | Identity: | 44/208 - (21%) |
---|---|---|---|
Similarity: | 81/208 - (38%) | Gaps: | 46/208 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 126 KKLPREQCPEQPIEE-------NIPLL----------GTD------NKLDVL-----CDETLNPG 162
Fly 163 SANSIEN------TLLVEPECTPFVKEPSGRCIVLYTFIARD-END---LSVERGEFVTVLNRED 217
Fly 218 PDWFWIMRSDGQEGFVPASFI-YPADSVRVLQQQKATLNAMETILQQGQQGQQSQQQQQPQLGLG 281
Fly 282 TDDLRYHGTELVM 294 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dlish | NP_611251.2 | SH3 | 61..111 | CDD:212690 | |
SH3 | 184..238 | CDD:214620 | 19/57 (33%) | ||
SH3 | 293..346 | CDD:212690 | 1/2 (50%) | ||
Sh3rf1 | NP_067481.2 | RING-HC_SH3RF1 | 8..55 | CDD:319662 | |
SH3 | 137..190 | CDD:418401 | 6/52 (12%) | ||
SH3_SH3RF1_2 | 200..254 | CDD:212863 | 18/54 (33%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 274..323 | 8/38 (21%) | |||
Interaction with RAC1. /evidence=ECO:0000250|UniProtKB:Q7Z6J0 | 292..362 | 6/20 (30%) | |||
Interaction with AKT2. /evidence=ECO:0000269|PubMed:14504284 | 446..549 | ||||
SH3 | 455..509 | CDD:418401 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 531..554 | ||||
PHA03247 | <539..851 | CDD:223021 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 687..750 | ||||
SH3_SH3RF_C | 836..890 | CDD:212719 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167839792 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |