DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and Sh3rf1

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_067481.2 Gene:Sh3rf1 / 59009 MGIID:1913066 Length:891 Species:Mus musculus


Alignment Length:208 Identity:44/208 - (21%)
Similarity:81/208 - (38%) Gaps:46/208 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 KKLPREQCPEQPIEE-------NIPLL----------GTD------NKLDVL-----CDETLNPG 162
            |.|...||.:||..:       .||.|          |.:      :|.|::     .||....|
Mouse   110 KDLQSSQCGQQPRVQAWSPPVRGIPQLPCAKALYNYEGKEPGDLKFSKGDIIILRRQVDENWYHG 174

  Fly   163 SANSIEN------TLLVEPECTPFVKEPSGRCIVLYTFIARD-END---LSVERGEFVTVLNRED 217
            ..:.:..      ..:::|     :.:|..:|..||.|..:| |.|   |...:.:.:||:.|.|
Mouse   175 EVSGVHGFFPTNFVQIIKP-----LPQPPPQCKALYDFEVKDKEADKDCLPFAKDDVLTVIRRVD 234

  Fly   218 PDWFWIMRSDGQEGFVPASFI-YPADSVRVLQQQKATLNAMETILQQGQQGQQSQQQQQPQLGLG 281
            .:|...|.:| :.|..|.|:: :.:.:.::::..|..:..::|........|.:...:.|.....
Mouse   235 ENWAEGMLAD-KIGIFPISYVEFNSAAKQLIEWDKPPVPGVDTAECPSATAQSTSASKHPDTKKN 298

  Fly   282 TDDLRYHGTELVM 294
            |.. |:..|.|.|
Mouse   299 TRK-RHSFTSLTM 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690
SH3 184..238 CDD:214620 19/57 (33%)
SH3 293..346 CDD:212690 1/2 (50%)
Sh3rf1NP_067481.2 RING-HC_SH3RF1 8..55 CDD:319662
SH3 137..190 CDD:418401 6/52 (12%)
SH3_SH3RF1_2 200..254 CDD:212863 18/54 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 274..323 8/38 (21%)
Interaction with RAC1. /evidence=ECO:0000250|UniProtKB:Q7Z6J0 292..362 6/20 (30%)
Interaction with AKT2. /evidence=ECO:0000269|PubMed:14504284 446..549
SH3 455..509 CDD:418401
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 531..554
PHA03247 <539..851 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 687..750
SH3_SH3RF_C 836..890 CDD:212719
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839792
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.