DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and SH3RF1

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_065921.2 Gene:SH3RF1 / 57630 HGNCID:17650 Length:888 Species:Homo sapiens


Alignment Length:107 Identity:26/107 - (24%)
Similarity:49/107 - (45%) Gaps:13/107 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AVGVLGMGRITGSSSIETLVRVGIEKEHGLSPDSK---MVVLHDFTPCVDDELEVKRGQLVNILY 88
            |....|||....:.|.:.:..        |.|.::   .|.::.:||..:||||:::|::..:..
Human   420 AAAAAGMGPRPMAGSTDQIAH--------LRPQTRPSVYVAIYPYTPRKEDELELRKGEMFLVFE 476

  Fly    89 R-ENDWVYVIGQDSRQEGFIPFSYCAPCNTQLADLAVKKKLP 129
            | ::.|.......:.:.|..|.:|.||. |:....|.:.|:|
Human   477 RCQDGWFKGTSMHTSKIGVFPGNYVAPV-TRAVTNASQAKVP 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 12/53 (23%)
SH3 184..238 CDD:214620
SH3 293..346 CDD:212690
SH3RF1NP_065921.2 RING 11..56 CDD:238093
SH3 137..190 CDD:302595
SH3_SH3RF1_2 200..254 CDD:212863
SH3_SH3RF1_3 449..503 CDD:212859 13/53 (25%)
SH3_SH3RF_C 833..887 CDD:212719
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149740
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.