DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and sorbs2a

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_017211485.1 Gene:sorbs2a / 571008 ZFINID:ZDB-GENE-070308-2 Length:1592 Species:Danio rerio


Alignment Length:331 Identity:76/331 - (22%)
Similarity:122/331 - (36%) Gaps:93/331 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GRITGSSSIETLVRVGIEKEHGLSPDSKMVV------------LHDFTPCVDDELEVKRGQLVNI 86
            ||||..|.     |:..|:|......:.:::            ::||......|:..|:|..|||
Zfish  1339 GRITPQSR-----RLTPEREVSSKQMTYLILSSLLHQKQSARAIYDFKAQSAKEISFKKGDAVNI 1398

  Fly    87 LYRENDWVYVIGQDSRQEGFIPFSYCAPCNTQLADLAVKKKLPREQCPEQPIEENIPLLGTDNKL 151
            : |:.|..:..|:...:.|..|.||            |:|....|:  .||              
Zfish  1399 I-RQIDSNWYEGEHRGRIGIFPISY------------VEKVASPER--RQP-------------- 1434

  Fly   152 DVLCDETLNPGSANSIENTLLVEPECTPFVKEPSGRCIVLYTFIARDENDLSVERGEFVTVLNRE 216
                                 |.|.....|:| .|..|..|.|.|....:||:.:||.|.:|.:.
Zfish  1435 ---------------------VRPPPPAQVRE-MGEAIARYNFNADTNVELSLRKGERVILLRKV 1477

  Fly   217 DPDWFWIMRSDGQEGFVPAS---FIYPADSVRVLQQQKATLNAMETILQQGQQGQQSQQQQQPQL 278
            |.:|:        ||.:|.|   .|:|...|.|::...:     ::...||.......|::..| 
Zfish  1478 DQNWY--------EGKIPGSNKQGIFPVSYVDVIKGSPS-----KSPSHQGDTHTYRAQKKMMQ- 1528

  Fly   279 GLGTDDLRYHGTELVMLYDYKAQAPDDLYLSVRRGDWIYADLTNQTVDGWLWAYAPKTRKYGFIP 343
                |.....|.....:|:|..:..|:|.|  :.||.:  |:..:..|||....:.:||.:|..|
Zfish  1529 ----DSQHAGGDPFQAVYNYVPRNEDELEL--KEGDVV--DVVERCDDGWFVGTSRRTRLFGTFP 1585

  Fly   344 KAYARP 349
            ..|.:|
Zfish  1586 GNYVKP 1591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 13/61 (21%)
SH3 184..238 CDD:214620 17/56 (30%)
SH3 293..346 CDD:212690 15/52 (29%)
sorbs2aXP_017211485.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583895
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.