DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and SH3GLB2

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_006717251.1 Gene:SH3GLB2 / 56904 HGNCID:10834 Length:428 Species:Homo sapiens


Alignment Length:297 Identity:54/297 - (18%)
Similarity:91/297 - (30%) Gaps:107/297 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CPVRMRRDKKKATNASIERD--------------LPAVGVLGMG-RITGSSS------------- 41
            |..|:::.|.....|:.|.|              |.|....|.| |:..|||             
Human   172 CKARLKKAKAAEAKATCEGDTVPDFQETRPRNYILSASASAGTGSRVQLSSSPLPCWPLLLPSPQ 236

  Fly    42 -------------------------IETLVRVGIEKEHGLSPDSKMVVLHDF--------TPCVD 73
                                     :..|:..||...|    .:.:..||:|        ..|..
Human   237 LWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTH----VNHLRCLHEFVKSQTTYYAQCYR 297

  Fly    74 DELEVKRGQLVNILYRENDWVYVIGQDSRQEGFIPFSYCAPCNTQLADLAVKKKLPREQCPEQPI 138
            ..|:::: ||                .|.|....|.::..  .|:.|...:....|.......|:
Human   298 HMLDLQK-QL----------------GSSQGAIFPGTFVG--TTEPASPPLSSTSPTTAAATMPV 343

  Fly   139 EENIPLLGTDNKLDVLCDETLNPGSANSIENTLLVEPECTPFVKEPSGRCIVLYTFIARDENDLS 203
            ..::..|....:..:..:|...|.|.                    :.:..|||.:.|.|.::|:
Human   344 VPSVASLAPPGEASLCLEEVAPPASG--------------------TRKARVLYDYEAADSSELA 388

  Fly   204 VERGEFVTV--LNREDPDWFWIMRSDGQEGFVPASFI 238
            :...|.:||  |...||||. |.....::|.||.:::
Human   389 LLADELITVYSLPGMDPDWL-IGERGNKKGKVPVTYL 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 10/57 (18%)
SH3 184..238 CDD:214620 18/55 (33%)
SH3 293..346 CDD:212690
SH3GLB2XP_006717251.1 BAR_Endophilin_B2 21..306 CDD:153301 23/138 (17%)
SH3_Endophilin_B2 372..426 CDD:212877 18/54 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149739
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.