DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and sh3rf1

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001038952.2 Gene:sh3rf1 / 556523 ZFINID:ZDB-GENE-030131-6288 Length:880 Species:Danio rerio


Alignment Length:315 Identity:72/315 - (22%)
Similarity:105/315 - (33%) Gaps:83/315 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ATNASIERDLPAVGVLGMGRITGSSSIETLVRV-GIEKEHGLSPDSKMVVLHDFT-------PCV 72
            |....||.|.|:.|  |.....|.||..:..:. |.:|..|...:||.  .|.||       ||:
Zfish   270 AARQLIELDKPSEG--GGDSSEGPSSSSSGPQANGSQKAPGEKKNSKK--RHSFTSLTMSHKPCL 330

  Fly    73 -----DDELEVKRGQLVNILYRENDWVYV-IGQDSR-------------QEGFI----PFS---- 110
                 ...:|:....|::   ..|..... ||:.|.             ..|.|    |.|    
Zfish   331 APPPQRHSMEISGPVLIS---SSNPTAAARIGELSGGLSSSAPSQVHICTTGLIVTPPPSSPVTT 392

  Fly   111 ---YCAPCNTQLADLAVKKKLPREQCPEQPIEENIPLLGTDNKLDVLCDETLNPGSANSIENTLL 172
               :..|..|..|.:.|....|.   |..|.:....::|.         ..||.|...|      
Zfish   393 ATVFTFPPETSYASIPVDALPPP---PPPPPQSQSSVVGA---------AALNAGQRPS------ 439

  Fly   173 VEPECTPFVKEPSGR-----CIVLYTFIARDENDLSVERGEFVTVLNREDPDWF-WIMRSDGQEG 231
                  |...:.|||     .:.::.:..|.|::|.:.:||...||.|....|| ......|:.|
Zfish   440 ------PAAGDQSGRQRPTVYVAMFPYSPRKEDELELRKGEMFLVLERCQDGWFKGTSMHTGKIG 498

  Fly   232 FVPASFIYPAD-SVRVLQQQKATLNAMETILQQGQQGQQSQQQQQPQLGLGTDDL 285
            ..|.:::.|.. :|....|.|..|    |:..|..:|...   ..|...||:.||
Zfish   499 VFPGNYMSPVSRTVSGSSQPKVPL----TLCSQAGRGVTI---VSPSSALGSMDL 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 16/86 (19%)
SH3 184..238 CDD:214620 16/59 (27%)
SH3 293..346 CDD:212690
sh3rf1NP_001038952.2 RING 24..69 CDD:238093
SH3_SH3RF1_1 148..201 CDD:212860
SH3_SH3RF1_2 211..265 CDD:212863
SH3_SH3RF1_3 453..507 CDD:212859 13/53 (25%)
SH3_SH3RF_C 825..879 CDD:212719
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583880
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.