DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and Ncf4

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_006242001.1 Gene:Ncf4 / 500904 RGDID:1593157 Length:355 Species:Rattus norvegicus


Alignment Length:204 Identity:46/204 - (22%)
Similarity:78/204 - (38%) Gaps:34/204 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 FTPCVDDELEVK-RGQLVNILYRENDWVYVIGQDSRQEGFIPFSYCAPCNTQLADLAVKKKLPRE 131
            ::.|....:||| :|....::||.....|.: |...:|.|.|.|..:|....|..|..|..:..:
  Rat    51 YSACTVFVIEVKTKGGSKYLIYRRYRQFYAL-QSKLEERFGPESKNSPFTCSLPTLPAKVYMGVK 114

  Fly   132 QCPEQPIEENIPLLGTDNK------LDVLCDETL------NPGSANSIENTLL-----------V 173
            |   :..|..||.|....|      :.||.|..:      :...|..:...|.           |
  Rat   115 Q---EIAETRIPALNAYMKNLLSLPVCVLMDPDVRIFFYQSAYDAEQVPQALRRLRPRTRKIKGV 176

  Fly   174 EPECTPFVKEPSGRCIVLYTFIARDENDLSVERGEFVTVLNREDPDWFWIMRSDGQEGFVPASFI 238
            .|:.....:..:.|...|:.|....:.:||.:.|:.:.:|::.:.||. ...:.|..|..|.||:
  Rat   177 TPQGPSMDRMEAPRAEALFDFTGNSKLELSFKAGDVIFLLSKINKDWL-EGTTQGATGIFPGSFV 240

  Fly   239 -----YPAD 242
                 :|.|
  Rat   241 KILKDFPED 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 12/43 (28%)
SH3 184..238 CDD:214620 13/53 (25%)
SH3 293..346 CDD:212690
Ncf4XP_006242001.1 PX_p40phox 56..157 CDD:132792 25/104 (24%)
SH3_p40phox 190..243 CDD:212802 14/53 (26%)
PB1_P40 254..345 CDD:99721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.