DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and NPHP1

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_006712614.1 Gene:NPHP1 / 4867 HGNCID:7905 Length:768 Species:Homo sapiens


Alignment Length:268 Identity:60/268 - (22%)
Similarity:108/268 - (40%) Gaps:64/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EKE----HGLSPDSKMVVLHDFTPCVDDELEVKRGQLVNILYREND--WVYVIGQDSR-QEGFIP 108
            |||    |..|...:.:.:.|||.....:|..|:|:::.::.::.|  |   |.:|:: .||.:|
Human   142 EKEENESHKWSTGEEYIAVGDFTAQQVGDLTFKKGEILLVIEKKPDGWW---IAKDAKGNEGLVP 203

  Fly   109 FSYCAPCNTQLADLAVKKKLPREQCPEQPIEENIPLLGTDNKLDVLCDETLNPGSANSIENTLLV 173
            .:|..|.:             .|:..::..||     |::..::.: |||     |:..|.....
Human   204 RTYLEPYS-------------EEEEGQESSEE-----GSEEDVEAV-DET-----ADGAEVKQRT 244

  Fly   174 EPECTPF---VKEPSGRCIV-----LYTFIARDENDLSVERGEFVTVLNREDPDW-FWIMRSDGQ 229
            :|..:..   :.|....|:|     .|..:      |...|.|.|...|..:..: .|.::|.|:
Human   245 DPHWSAVQKAISEAGIFCLVNHVSFCYLIV------LMRNRMETVEDTNGSETGFRAWNVQSRGR 303

  Fly   230 EGFVPASFIYPADSVRVLQQQKATLNAM------ETILQQGQQGQQSQQQQ--QPQL---GLGTD 283
            ...|....:...::|.||    .|:.|:      .|:.|..::|.|.:...  ||:|   .|...
Human   304 IFLVSKPVLQQINTVDVL----TTMGAIPAGFRPSTLSQLLEEGNQFRANYFLQPELMPSQLAFR 364

  Fly   284 DLRYHGTE 291
            ||.:..||
Human   365 DLMWDATE 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 13/52 (25%)
SH3 184..238 CDD:214620 12/59 (20%)
SH3 293..346 CDD:212690
NPHP1XP_006712614.1 SH3_Nephrocystin 156..209 CDD:212704 14/55 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15176
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.