DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and sh3glb2b

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_021331719.1 Gene:sh3glb2b / 394094 ZFINID:ZDB-GENE-040426-833 Length:421 Species:Danio rerio


Alignment Length:168 Identity:39/168 - (23%)
Similarity:60/168 - (35%) Gaps:70/168 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 SYCAPCNTQLADLAVKKKL---------------------------------PREQCPEQPIEEN 141
            :|.|.|:..:.||  :|:|                                 |....|.:|    
Zfish   281 AYYAQCHRHMQDL--QKELSSANGDTFPNAFAVNASTSGVSAGPSPLSTGTQPGPSSPSRP---- 339

  Fly   142 IPLLGTDNKLDVLCDETLNPGSANSIE-NTLLVEPECTPFVKEP---SGRCIVLYTFIARDENDL 202
                               |...|::| |||.:|.     ||.|   :.:..|||.:.|.|.::|
Zfish   340 -------------------PNPPNALESNTLKIEE-----VKPPATGTRKAKVLYDYDAADTSEL 380

  Fly   203 SVERGEFVTV--LNREDPDWFWIMRSDGQEGFVPASFI 238
            |:...|.:||  :...||||. |.....|:|.||.:::
Zfish   381 SLLADELITVYTVPGMDPDWL-IGERGNQKGKVPVTYL 417

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity