DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and sh3gl2a

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_957410.1 Gene:sh3gl2a / 394091 ZFINID:ZDB-GENE-040121-3 Length:347 Species:Danio rerio


Alignment Length:253 Identity:51/253 - (20%)
Similarity:96/253 - (37%) Gaps:69/253 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FLCPVRMRRDK---------KKATNASIERDLPAVGVLGMGRITGSSSIETLVRVGIEKEHGLSP 58
            |:.|::...||         ||.....::.|...   ...|::|     |..::..:||      
Zfish   139 FIDPLQNIHDKDLKEIQHHLKKLEGRRLDFDYKK---KRQGKVT-----EDEIKQALEK------ 189

  Fly    59 DSKMVVLHDFTPCVDDELEVKRGQLVNILYRENDWVYVIGQDSRQEGFI--PFSYCAPCNTQLAD 121
                         .||..|:....:.|:|  |||    |.|.|:....:  ..:|    :.|.|:
Zfish   190 -------------FDDSKEIAEQSMFNLL--END----IEQVSQLSALVQAQVNY----HRQAAE 231

  Fly   122 L------AVKKKLPREQCPEQPIEENIPLLGTDNKLDVLCDETLNPGSANSIENTLLVEPECTPF 180
            :      .::.::....|  :|..|.:|...|  .||...:...:.|.:....:...::..|   
Zfish   232 ILQQLSSKIEDRIREASC--KPKREYVPKPRT--SLDFSENHNGSIGHSGPSRSPAPMDQPC--- 289

  Fly   181 VKEPSGRCIVLYTFIARDENDLSVERGEFVTVLNREDPDWFWIMRSDGQEGFVPASFI 238
                   |..||.|...:|.:|..:.|:.:|:.::.|.:|:..| .:||.||.|.:::
Zfish   290 -------CRALYDFDPENEGELGFKEGDIITLTSKIDDNWYEGM-VNGQSGFFPVNYV 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 11/51 (22%)
SH3 184..238 CDD:214620 16/53 (30%)
SH3 293..346 CDD:212690
sh3gl2aNP_957410.1 BAR_Endophilin_A1 25..247 CDD:153297 26/144 (18%)
SH3_Endophilin_A 288..342 CDD:212737 17/63 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583890
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.