DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Dlish and SH3RF3

DIOPT Version :9

Sequence 1:	NP_611251.2	Gene:	Dlish / 37014	FlyBaseID:	FBgn0034264	Length:	355	Species:	Drosophila melanogaster
Sequence 2:	NP_001092759.1	Gene:	SH3RF3 / 344558	HGNCID:	24699	Length:	882	Species:	Homo sapiens

Alignment Length:	92	Identity:	25/92 - (27%)
Similarity:	41/92 - (44%)	Gaps:	18/92 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly   161 PGS-------ANSIENTL--LVEPECTPFVKEPSGRCIV-----LYTFIARDENDLSVERGEFVT 211
            |||       |.|...:|  |......|..|.|   |::     ||::..::..||...:|:.:.
Human   161 PGSPVFLSAAAGSTAGSLRELATSRTAPAAKNP---CLLPYGKALYSYEGKEPGDLKFNKGDIIV 222

  Fly   212 VLNREDPDWFWIMRSDGQEGFVPASFI 238
            :..:.|..|:. ....|.:||:|||:|
Human   223 LRRKVDEQWYH-GELHGTQGFLPASYI 248

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Dlish	NP_611251.2	SH3	61..111	CDD:212690
		SH3	184..238	CDD:214620	15/58 (26%)
		SH3	293..346	CDD:212690
SH3RF3	NP_001092759.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	18..42
		RING	56..98	CDD:238093
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	124..159
		SH3_SH3RF3_1	197..250	CDD:212861	14/53 (26%)
		SH3_SH3RF3_2	260..314	CDD:212864
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	368..399
		Interaction with RAC1. /evidence=ECO:0000269\|PubMed:20696164	369..439
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	433..458
		SH3_SH3RF3_3	467..523	CDD:212858
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	575..664
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	693..747
		SH3_SH3RF_C	827..881	CDD:212719
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165149750
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.840