Sequence 1: | NP_611251.2 | Gene: | Dlish / 37014 | FlyBaseID: | FBgn0034264 | Length: | 355 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009296537.1 | Gene: | sh3glb1b / 334911 | ZFINID: | ZDB-GENE-030131-6851 | Length: | 401 | Species: | Danio rerio |
Alignment Length: | 208 | Identity: | 42/208 - (20%) |
---|---|---|---|
Similarity: | 68/208 - (32%) | Gaps: | 59/208 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 SSIETLVRVGIEKEHGLSPDSKMVVLHDFTPCVDDELEVKRGQLVNILYRENDWVYVIG---QDS 101
Fly 102 RQEGFIPFSYC---APCNTQLADLAVKKKLPREQCPEQPIEENIPLLGTDNKLDVLCDETLNPGS 163
Fly 164 ANSIENTLLVEPECTPFVKEPSG--RCIVLYTFIARDENDLSVERGEFVTVLNREDPDWFWIMRS 226
Fly 227 DG-QEGFVPASFI 238 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dlish | NP_611251.2 | SH3 | 61..111 | CDD:212690 | 8/52 (15%) |
SH3 | 184..238 | CDD:214620 | 19/56 (34%) | ||
SH3 | 293..346 | CDD:212690 | |||
sh3glb1b | XP_009296537.1 | BAR | 21..286 | CDD:299863 | 10/62 (16%) |
SH3_Endophilin_B1 | 341..401 | CDD:212878 | 19/57 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170583884 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |