DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and sh3glb1b

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_009296537.1 Gene:sh3glb1b / 334911 ZFINID:ZDB-GENE-030131-6851 Length:401 Species:Danio rerio


Alignment Length:208 Identity:42/208 - (20%)
Similarity:68/208 - (32%) Gaps:59/208 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SSIETLVRVGIEKEHGLSPDSKMVVLHDFTPCVDDELEVKRGQLVNILYRENDWVYVIG---QDS 101
            :.|..|:..||...|.          |... |::|.::.:..      |....:.|.:.   |..
Zfish   240 AEITRLLLEGISSTHA----------HHLR-CLNDFVDAQAA------YYAQCYQYTVNLQKQLG 287

  Fly   102 RQEGFIPFSYC---APCNTQLADLAVKKKLPREQCPEQPIEENIPLLGTDNKLDVLCDETLNPGS 163
            .|....|.::.   .|..:..|.:.|....|....|..|                       |..
Zfish   288 SQTAIFPSTFSNNNQPSGSSSASVCVPTAPPAASLPAPP-----------------------PSQ 329

  Fly   164 ANSIENTLLVEPECTPFVKEPSG--RCIVLYTFIARDENDLSVERGEFVTVLNREDPDWFWIMRS 226
            |:...|.|          :..||  :..|||.:.|....:||:...|.:||.:....|..|:|..
Zfish   330 ASPALNEL----------RSSSGTRKARVLYDYDAASSTELSLLADEVITVSSVPGMDSDWLMGQ 384

  Fly   227 DG-QEGFVPASFI 238
            .| |:|.||.:::
Zfish   385 RGNQKGKVPITYL 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 8/52 (15%)
SH3 184..238 CDD:214620 19/56 (34%)
SH3 293..346 CDD:212690
sh3glb1bXP_009296537.1 BAR 21..286 CDD:299863 10/62 (16%)
SH3_Endophilin_B1 341..401 CDD:212878 19/57 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583884
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.