DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and Nphp1

DIOPT Version :10

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001300931.1 Gene:Nphp1 / 296136 RGDID:1308136 Length:701 Species:Rattus norvegicus


Alignment Length:177 Identity:38/177 - (21%)
Similarity:74/177 - (41%) Gaps:42/177 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 IVLYTFIARDENDLSVERGEFVTVLNREDPDWFWIMR-SDGQEGFVPASFIYPADSVRVLQQQKA 252
            |.|..|.|:...||:.::|:.:.::.:. ||.:|:.: ::|.||.:|.:::.|.:....|:..:.
  Rat   162 IALGDFAAQQAGDLTFKKGDILHIIEKR-PDGWWLAKDAEGGEGLIPRTYLEPYNKEDKLESSEG 225

  Fly   253 TLNA-METILQQGQQGQQSQQQQQPQLGLGTDDLRYHGTELVMLYDYKA------QAPDDLYLSV 310
            :... .|.:.:.|:.|:..:.                |.|.|.:.|..|      |..|..:.:|
  Rat   226 SEEGDEEGVGEDGEDGEDGED----------------GEEDVEVVDETADGAQVKQRTDSHWSAV 274

  Fly   311 RRGDWIYADLTNQ--TVDGWLWAYAPKTRKYGFIPKAYARPPAMTSL 355
            |:.      ::.|  |||        .....|.||..: ||..::.|
  Rat   275 RKA------ISEQINTVD--------VLATMGAIPAGF-RPSTLSQL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690
SH3 184..238 CDD:214620 14/49 (29%)
SH3 293..346 CDD:212690 14/60 (23%)
Nphp1NP_001300931.1 SH3_Nephrocystin 161..213 CDD:212704 14/51 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.