DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and Sh3rf3

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_017457292.1 Gene:Sh3rf3 / 294557 RGDID:1589772 Length:878 Species:Rattus norvegicus


Alignment Length:252 Identity:53/252 - (21%)
Similarity:101/252 - (40%) Gaps:48/252 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCPVRMRRDKKKATNASIERDLPAVGVLGMGRITGSSSIETLVRVGIEKEHGLSPDSKMVVLHDF 68
            :|| |.......|.:|....::.|..:.|....|.:|.:.|...:..    |..||.|       
  Rat   655 MCP-RPAIPFTSAASAITPPNVSAANLSGEVGGTPTSGLSTPSPINA----GYKPDDK------- 707

  Fly    69 TPCVDDELEVKRGQLVNILYRENDWVYVIGQDSRQEGFIPFSYCAPCNTQLA-DLAVKKKLPREQ 132
                .:|.:.|:..|:.:|         .|..::::...|.|.....:.|.| |.:::..:..|.
  Rat   708 ----KNEKKEKKSGLLKLL---------AGASTKKKARSPPSVSPTHDPQSAMDSSLQGAVGPEV 759

  Fly   133 CP--------EQPIEENI-------PLLGTDNKLDVLCDETLNPGSANSIENTLLVEPECTPFVK 182
            .|        ..|:|..:       ||......||:  :.:|:| |..:..:|..:.||..|..:
  Rat   760 SPLTIHGRAGSCPVESEMQGAIGLEPLHRKAGSLDL--NFSLSP-SRQATLSTASIRPEPKPLPR 821

  Fly   183 EPSGRCIVLYTFIARDENDLSVERGEFVTVLNREDPDWF-WIMRSDGQEGFVPASFI 238
            |   |..|:.::..:.|.::.::.|:.|.|..:.:..|| ..::.:|:.|..|.||:
  Rat   822 E---RYRVVVSYPPQSEAEIELKEGDIVFVHRKHEDGWFKGTLQRNGRTGLFPGSFV 875

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 7/49 (14%)
SH3 184..238 CDD:214620 12/54 (22%)
SH3 293..346 CDD:212690
Sh3rf3XP_017457292.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.