DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and Sh3glb1

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_006233493.1 Gene:Sh3glb1 / 292156 RGDID:1304859 Length:402 Species:Rattus norvegicus


Alignment Length:212 Identity:47/212 - (22%)
Similarity:78/212 - (36%) Gaps:54/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RITGS-----SSIETLVRVGIEKEHGLSPDSKMVVLHDFTPCVDDELEVKRGQLVNILYRENDWV 94
            |||.|     :.|..|:..||...|.          |... |::|.:|.:               
  Rat   233 RITQSEFDRQAEITRLLLEGISSTHA----------HHLR-CLNDFVEAQ--------------- 271

  Fly    95 YVIGQDSRQEGFIPFSYCAPCNTQLADLAVKKKLPREQCPEQPIEENIPLLGTDNKLDVLCDETL 159
                          .:|.|.|...:.||  :|:|  ...|...:..|....||  .:......|:
  Rat   272 --------------MTYYAQCYQYMLDL--QKQL--GSFPSNYVSNNNQTSGT--PVPYTLSNTI 316

  Fly   160 NPGSANSIENTLLVEPECTPFVKEPSG--RCIVLYTFIARDENDLSVERGEFVTVLNREDPDWFW 222
            .|.:..|..:.::..|.....:|:.|.  :..|||.:.|.:..:||:...|.:||.:....|..|
  Rat   317 GPSAVASTGSLVITCPPNLSDLKDSSSTRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDW 381

  Fly   223 IMRSDG-QEGFVPASFI 238
            :|...| |:|.||.:::
  Rat   382 LMGERGNQKGKVPITYL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 4/49 (8%)
SH3 184..238 CDD:214620 18/56 (32%)
SH3 293..346 CDD:212690
Sh3glb1XP_006233493.1 BAR_Endophilin_B1 24..289 CDD:153300 19/97 (20%)
SH3_Endophilin_B1 342..402 CDD:212878 18/57 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.