DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and Sh3rf3

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_766376.2 Gene:Sh3rf3 / 237353 MGIID:2444637 Length:878 Species:Mus musculus


Alignment Length:254 Identity:54/254 - (21%)
Similarity:99/254 - (38%) Gaps:48/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AFLCPVRMRRDKKKATNASIERDLPAVGVLGMGRITGSSSIETLVRVGIEKEHGLSPDSKMVVLH 66
            |.:||    |.....|:|:.....|.|....:....|.:.|..|....:... |..||.|     
Mouse   653 AQMCP----RPAIPFTSAASAITPPNVSAANLSGEVGGTPISGLSTPSLINT-GFKPDDK----- 707

  Fly    67 DFTPCVDDELEVKRGQLVNILYRENDWVYVIGQDSRQEGFIPFSYCAPCNTQLA-DLAVKKKLPR 130
                  .:|.:.|:..|:.:|         .|..::::...|.|.....:.|.| |.:::..:..
Mouse   708 ------KNEKKEKKSGLLKLL---------AGASTKKKSRSPPSVSPTHDPQSAMDTSLQGAMGP 757

  Fly   131 EQCP--------EQPIEENI-------PLLGTDNKLDVLCDETLNPGSANSIENTLLVEPECTPF 180
            |..|        ..|||..:       ||......||:  :.:|:| |..:..:...:.||..|.
Mouse   758 EVSPLTVHGRAGSCPIESEMQGAIGLEPLHRKAGSLDL--NFSLSP-SRQATLSMASIRPEPKPL 819

  Fly   181 VKEPSGRCIVLYTFIARDENDLSVERGEFVTVLNREDPDWF-WIMRSDGQEGFVPASFI 238
            .:|   |..|:.::..:.|.::.::.|:.|.|..:.:..|| ..::.:|:.|..|.||:
Mouse   820 PRE---RYRVVVSYPPQSEAEIELKEGDIVFVHKKHEDGWFKGTLQRNGRTGLFPGSFV 875

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 7/49 (14%)
SH3 184..238 CDD:214620 12/54 (22%)
SH3 293..346 CDD:212690
Sh3rf3NP_766376.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..40
RING 51..93 CDD:238093
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..145
SH3 190..243 CDD:302595
SH3 253..307 CDD:302595
Interaction with RAC1. /evidence=ECO:0000250|UniProtKB:Q8TEJ3 364..433
SH3_SH3RF3_3 461..517 CDD:212858
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..659 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 688..758 16/90 (18%)
SH3_SH3RF_C 823..877 CDD:212719 13/53 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839802
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.