DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and C26C6.8

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001361835.1 Gene:C26C6.8 / 182936 WormBaseID:WBGene00007742 Length:270 Species:Caenorhabditis elegans


Alignment Length:330 Identity:92/330 - (27%)
Similarity:138/330 - (41%) Gaps:95/330 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GSSSIETLVRVGIEKEHGLSPDSKMV----------VLHDFTPCVDDELEVKRGQLVNILYREND 92
            |..||...|..|...::|...||..|          :..:||..|.||:.|.||..|..:||::.
 Worm     2 GIRSIFWKVVSGRVPDNGGWVDSMQVDHFDPYTPGQLTKNFTATVADEISVTRGTTVKAIYRDDQ 66

  Fly    93 WVYVIGQDSRQEGFIPFSYC-APCNTQLADLAVKKK-------LPR--EQCPEQPIEENIPLL-- 145
            |:||...|.| :||:|.:|| ...|::..:   |||       |.|  |:...|...:::|:.  
 Worm    67 WIYVEVSDGR-KGFVPQTYCKLLLNSKHGE---KKKVIGSSATLDRRWEKSNLQRFIDSLPVQKE 127

  Fly   146 -GTDNKLDVLCDETLNPGSANSIENTLLVEPECTPFVKEPSGRCIVLYTFIARDENDLSVERGEF 209
             |...|:|.:|:..                               :|.:|.....:|:||:.||.
 Worm   128 EGEVFKMDEICEVQ-------------------------------ILQSFDGSAPDDISVKDGES 161

  Fly   210 VTVLNREDPDWFWIMRSDGQEGFVPASFI-YPADSVRVLQQQKATLNAMETILQQGQQGQQSQQQ 273
            |||||..||:|.:|..||.|.||||:|.: .|.:   :|||....:..                 
 Worm   162 VTVLNISDPEWTYIRNSDNQSGFVPSSHVKIPHE---ILQQASRVIKE----------------- 206

  Fly   274 QQPQLGLGTDDLRYHGTELVMLYDYKAQAPDDLYLSVRRGDWIYADLTNQTVDGWLWAYAPKTRK 338
                        ::....|:::..:..::|.|  |:||.|:||  ..|.:.||.||||......|
 Worm   207 ------------KWENENLLVVEPFSGRSPLD--LTVRPGEWI--KCTGRPVDDWLWAVRIADEK 255

  Fly   339 YGFIP 343
            .||||
 Worm   256 QGFIP 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 20/59 (34%)
SH3 184..238 CDD:214620 24/53 (45%)
SH3 293..346 CDD:212690 20/51 (39%)
C26C6.8NP_001361835.1 SH3_2 35..88 CDD:369452 21/53 (40%)
SH3 136..191 CDD:214620 25/85 (29%)
SH3 215..264 CDD:214620 20/50 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I8047
eggNOG 1 0.900 - - E1_28HJG
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I3607
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49370
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016693
OrthoInspector 1 1.000 - - oto19974
orthoMCL 1 0.900 - - OOG6_117945
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16920
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.800

Return to query results.
Submit another query.