DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and Ncf4

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_032703.2 Gene:Ncf4 / 17972 MGIID:109186 Length:339 Species:Mus musculus


Alignment Length:222 Identity:50/222 - (22%)
Similarity:82/222 - (36%) Gaps:46/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 IEKEHGLSPDSKMVVLHDFTPCVDDELEVK-RGQLVNILYRENDWVYVIGQDSRQEGFIPFSYCA 113
            ||::.|.:.....|:            ||| :|....::||.....|.: |...:|.|.|.|..:
Mouse    29 IEEKRGFTSHFVFVI------------EVKTKGGSKYLIYRRYRQFYAL-QSKLEERFGPESKNS 80

  Fly   114 PCNTQLADLAVKKKLPREQCPEQPIEENIPLLGTDNK------LDVLCDETL------NPGSANS 166
            |....|..|..|..:..:|   :..|..||.|....|      :.||.|..:      :...|..
Mouse    81 PFTCSLPTLPAKVYMGAKQ---EIAETRIPALNAYMKNLLSLPVCVLMDPDVRIFFYQSAYDAEQ 142

  Fly   167 IENTLL-----------VEPECTPFVKEPSGRCIVLYTFIARDENDLSVERGEFVTVLNREDPDW 220
            :...|.           |.|:.....:..:.|...|:.|....:.:||.:.|:.:.:|::.:.||
Mouse   143 VPQALRRLRPRTRKIKGVSPQGAIMDRMEAPRAEALFDFTGNSKLELSFKAGDVIFLLSKINKDW 207

  Fly   221 FWIMRSDGQEGFVPASFI-----YPAD 242
            . ...|.|..|..|.||:     :|.|
Mouse   208 L-EGTSQGATGIFPGSFVKILKDFPED 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 12/50 (24%)
SH3 184..238 CDD:214620 14/53 (26%)
SH3 293..346 CDD:212690
Ncf4NP_032703.2 PX_p40phox 19..141 CDD:132792 29/127 (23%)
Phosphatidylinositol 3-phosphate binding. /evidence=ECO:0000250 58..60 0/1 (0%)
Phosphatidylinositol 3-phosphate binding. /evidence=ECO:0000250 92..94 1/1 (100%)
SH3_p40phox 174..227 CDD:212802 15/53 (28%)
PB1_P40 238..329 CDD:99721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839795
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.