DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and B0303.7

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_498918.3 Gene:B0303.7 / 176220 WormBaseID:WBGene00015128 Length:493 Species:Caenorhabditis elegans


Alignment Length:355 Identity:76/355 - (21%)
Similarity:120/355 - (33%) Gaps:97/355 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SSSIETLVRVGIEKEHGLSPDSKMVVLHDFTPCVDDELEVKRGQLVNILYR-ENDWVYVIGQDSR 102
            :.||.:.....|...:|::.       .|:.|...||:.::.|..|.|..: :.:|.|...|:.|
 Worm   180 TQSIPSYSAPAISTPYGIAK-------FDYAPTQSDEMGLRIGDTVLISKKVDAEWFYGENQNQR 237

  Fly   103 QEGFIPFSYCAPCNTQLADLAVKKKLPREQCPEQPIEENIPLLGT------DNKLDVLCDETLNP 161
            ..|.:|.||        .|:.:..|......|.:|...:....||      |...:...|.....
 Worm   238 TFGIVPSSY--------LDIKIPLKEAFTALPPRPAAPSGSSSGTYATAIYDYNSNEAGDLNFAV 294

  Fly   162 GSANSIE---NTLLVEPEC--------TPFV----------------------------KEPSGR 187
            ||...:.   |...:|.||        :.||                            ..|...
 Worm   295 GSQIMVTARVNEEWLEGECFGRSGIFPSQFVDCPNLYQVPMKQSAPSSAPSYSHPITNNSGPKQT 359

  Fly   188 CIVLYTFIARDENDLSVERGEFVTVLNREDPDWFWIM-RSDGQEGFVPASFIYPADSVRVLQQQK 251
            ..|.|.:.:...:||.:..|:.:|.|  ||.|..|:: ...||:|.||.:|:.|           
 Worm   360 VTVSYDYDSGVASDLRLFEGDVITAL--EDIDAQWLLAECRGQQGMVPKTFLGP----------- 411

  Fly   252 ATLNAMETILQQGQQGQQSQQQQQPQLGLGTDDLRYHGTELVMLYDYKAQAPDDLYLSVRRGD-- 314
                            .....::.|..|:......:...:.|...||.::.|..||  |.|||  
 Worm   412 ----------------PYGSPKKAPSKGIAEIACAFSPKKAVATGDYHSEDPKHLY--VTRGDHL 458

  Fly   315 WIYADLTNQTVDGWLWAYAPKTRKYGFIPK 344
            .|..|:.:....|.|.|:  ||...|.:||
 Worm   459 LIVEDVDDYYYKGKLEAF--KTLPAGILPK 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 13/50 (26%)
SH3 184..238 CDD:214620 17/54 (31%)
SH3 293..346 CDD:212690 20/54 (37%)
B0303.7NP_498918.3 SH3 194..247 CDD:214620 16/67 (24%)
SH3 275..326 CDD:302595 9/50 (18%)
SH3 356..409 CDD:214620 17/54 (31%)
SH3 432..490 CDD:214620 20/59 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164668
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.