Sequence 1: | NP_611251.2 | Gene: | Dlish / 37014 | FlyBaseID: | FBgn0034264 | Length: | 355 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_496298.1 | Gene: | nphp-1 / 174643 | WormBaseID: | WBGene00010898 | Length: | 682 | Species: | Caenorhabditis elegans |
Alignment Length: | 200 | Identity: | 45/200 - (22%) |
---|---|---|---|
Similarity: | 83/200 - (41%) | Gaps: | 38/200 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 LSPDSKMVVLHDFTPCVDDELEVKR------GQLVNILYRENDWVYVIGQDSRQEGFIPFSYCAP 114
Fly 115 CNTQLAD-LAVKKKLPREQ------CPEQPIEENIPL----LGTDNKLDVLCDETLNPGSANSIE 168
Fly 169 NTLLVEPECTPFVKEPSGRCIVLYTFIARDENDLSVERGEFVTVLNREDPDWFWIMRSDGQEGFV 233
Fly 234 PASFI 238 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dlish | NP_611251.2 | SH3 | 61..111 | CDD:212690 | 8/55 (15%) |
SH3 | 184..238 | CDD:214620 | 11/53 (21%) | ||
SH3 | 293..346 | CDD:212690 | |||
nphp-1 | NP_496298.1 | SH3 | 220..271 | CDD:302595 | 11/50 (22%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR15176 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |