DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and nphp-1

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_496298.1 Gene:nphp-1 / 174643 WormBaseID:WBGene00010898 Length:682 Species:Caenorhabditis elegans


Alignment Length:200 Identity:45/200 - (22%)
Similarity:83/200 - (41%) Gaps:38/200 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LSPDSKMVVLHDFTPCVDDELEVKR------GQLVNILYRENDWVYVIGQDSRQEGFIPFSYCAP 114
            |||:.:.:   .|:..||.:.|.::      |:..:.:|.:::     .:||..:     |....
 Worm    92 LSPEKEQL---SFSVSVDSQSEEEKPKMAAIGRRKSTMYNDDE-----SEDSDND-----SEIIE 143

  Fly   115 CNTQLAD-LAVKKKLPREQ------CPEQPIEENIPL----LGTDNKLDVLCDETLNPGSANSIE 168
            .:.||.| |..:.:.|::|      .|.|||....||    |....:||.:.....||...:|.|
 Worm   144 TDVQLDDPLPSQPQPPQQQHQQPQPKPRQPITITKPLESKTLNERQELDEVISRLQNPSRGDSGE 208

  Fly   169 NTLLVEPECTPFVKEPSGRCIVLYTFIARDENDLSVERGEFVTVLNREDPDWFWIMRSDGQEGFV 233
               ::||     |.......:.:.::.|..|.||.:.:|:...:.......|:..:...||.|.|
 Worm   209 ---VMEP-----VVVRGNVFVAIDSWDAEAEGDLELIKGKKYRITQTRSDGWWTALDEYGQRGLV 265

  Fly   234 PASFI 238
            |.:::
 Worm   266 PKTYL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 8/55 (15%)
SH3 184..238 CDD:214620 11/53 (21%)
SH3 293..346 CDD:212690
nphp-1NP_496298.1 SH3 220..271 CDD:302595 11/50 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15176
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.