Sequence 1: | NP_611251.2 | Gene: | Dlish / 37014 | FlyBaseID: | FBgn0034264 | Length: | 355 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_446387.1 | Gene: | Sh3gl2 / 116743 | RGDID: | 620276 | Length: | 352 | Species: | Rattus norvegicus |
Alignment Length: | 197 | Identity: | 46/197 - (23%) |
---|---|---|---|
Similarity: | 74/197 - (37%) | Gaps: | 33/197 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 EKEHGLSPDSKM-VVLHDFTPCVDDELEVKRGQLVNILYRENDWVYVIGQDSRQEGFI--PFSYC 112
Fly 113 APCNTQLADLAVKKKLPREQCPEQPIEENIPLLGTDNKLDVLCDETLNPGSANSIENTLLVEPEC 177
Fly 178 TPFVKEPSG------RCIVLYTFIARDENDLSVERGEFVTVLNREDPDWFWIMRSDGQEGFVPAS 236
Fly 237 FI 238 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dlish | NP_611251.2 | SH3 | 61..111 | CDD:212690 | 11/52 (21%) |
SH3 | 184..238 | CDD:214620 | 19/59 (32%) | ||
SH3 | 293..346 | CDD:212690 | |||
Sh3gl2 | NP_446387.1 | Binds and tubulates liposomes | 1..125 | ||
Membrane-binding amphipathic helix | 1..21 | ||||
BAR_Endophilin_A1 | 25..247 | CDD:153297 | 18/84 (21%) | ||
Required for dimerization upon membrane association | 60..87 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 246..289 | 11/55 (20%) | |||
SH3_Endophilin_A | 293..347 | CDD:212737 | 17/53 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166343638 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |