DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and Sh3gl2

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_446387.1 Gene:Sh3gl2 / 116743 RGDID:620276 Length:352 Species:Rattus norvegicus


Alignment Length:197 Identity:46/197 - (23%)
Similarity:74/197 - (37%) Gaps:33/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EKEHGLSPDSKM-VVLHDFTPCVDDELEVKRGQLVNILYRENDWVYVIGQDSRQEGFI--PFSYC 112
            :|..|..||.:: ..|..|    |:..|:....:.|:|  |.|    |.|.|:....:  ...|.
  Rat   172 KKRQGKIPDEELRQALEKF----DESKEIAESSMFNLL--EMD----IEQVSQLSALVQAQLEYH 226

  Fly   113 APCNTQLADLAVKKKLPREQCPEQPIEENIPLLGTDNKLDVLCDETLNPGSANSIENTLLVEPEC 177
            ......|..:.|:.:....|...||..|..|  .....|:....:...|....|...|       
  Rat   227 KQAVQILQQVTVRLEERIRQASSQPRREYQP--KPRMSLEFATGDGTQPNGGLSHTGT------- 282

  Fly   178 TPFVKEPSG------RCIVLYTFIARDENDLSVERGEFVTVLNREDPDWFWIMRSDGQEGFVPAS 236
                .:|:|      .|..||.|...:|.:|..:.|:.:|:.|:.|.:|:..| ..||.||.|.:
  Rat   283 ----PKPAGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGM-LHGQSGFFPIN 342

  Fly   237 FI 238
            ::
  Rat   343 YV 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 11/52 (21%)
SH3 184..238 CDD:214620 19/59 (32%)
SH3 293..346 CDD:212690
Sh3gl2NP_446387.1 Binds and tubulates liposomes 1..125
Membrane-binding amphipathic helix 1..21
BAR_Endophilin_A1 25..247 CDD:153297 18/84 (21%)
Required for dimerization upon membrane association 60..87
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..289 11/55 (20%)
SH3_Endophilin_A 293..347 CDD:212737 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343638
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.