DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and Sorbs2

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_038950035.1 Gene:Sorbs2 / 114901 RGDID:620061 Length:1811 Species:Rattus norvegicus


Alignment Length:372 Identity:79/372 - (21%)
Similarity:138/372 - (37%) Gaps:99/372 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFL-CPVRMRRDK----KKAT-----NASIERDLPAVGVLGMGRITGSSSIETLV-RVGIEKEH 54
            :||| .||..||.|    :|.|     .||:...|             .|:::.:. ::..||..
  Rat  1101 LAFLVSPVPFRRKKVLTPQKQTEQAKCKASVVEAL-------------DSALKDICDQIKAEKRR 1152

  Fly    55 GLSPDSKMV--VLHDFTPCVDDELEVKRGQLVNILYRENDWVYVIGQDSRQEGFIPFSYCAPCNT 117
            |..||:.::  ::.:..|.:.:     |...:|.|.|          ....:.|.|..       
  Rat  1153 GSLPDNSILHRLISELLPQIPE-----RNSSLNALKR----------SPMHQPFHPLP------- 1195

  Fly   118 QLADLAVKKKLPREQCPEQPIEENIPLLGTDNKL------DVL-CDETLNPGSANS----IENTL 171
              .|.|:...|.:..|...|...:.|.:.|.:..      .|| ..:..:|.|.:|    :..::
  Rat  1196 --QDGAIHCPLYQNDCGRMPHSASFPDVDTTSSYHAQDYGSVLSLQDHESPRSYSSTLTDLGRSV 1258

  Fly   172 LVEPECTP--FVKEPSGRCIVLYTFIARDENDLSVERGEFVTVLNREDPDWFWIMRSDGQEGFVP 234
            ..|...||  .||.|:.   .:|.|.|:...:||.::|:.|.:|.:.|.:|: .....|:.|..|
  Rat  1259 SRERRGTPEKEVKLPAK---AVYDFKAQTSKELSFKKGDTVYILRKIDQNWY-EGEHHGRVGIFP 1319

  Fly   235 ASFIYPADSVRVLQQQKATLNAMETILQQGQQGQQSQQQQQPQLGLGTDDLRYHGTELVMLYDYK 299
            .|::     .::...:||........:|.|:.|                       |.:..|::.
  Rat  1320 ISYV-----EKLTPPEKAQPARPPPPVQPGEIG-----------------------EAIAKYNFN 1356

  Fly   300 AQAPDDLYLSVRRGDWIYADLTNQTVDGWLWAYAPKTRKYGFIPKAY 346
            |..  ::.||:|:||.|.  |..:....|.....|.|.:.|..|.:|
  Rat  1357 ADT--NVELSLRKGDRII--LLKRVDQNWYEGKIPGTNRQGIFPVSY 1399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 7/51 (14%)
SH3 184..238 CDD:214620 15/53 (28%)
SH3 293..346 CDD:212690 14/52 (27%)
Sorbs2XP_038950035.1 Sorb 377..427 CDD:128735
SH3_Sorbs2_1 1272..1326 CDD:212853 15/62 (24%)
SH3_Sorbs2_2 1347..1403 CDD:212856 17/80 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343641
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.