DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and GRAP

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_006604.1 Gene:GRAP / 10750 HGNCID:4562 Length:217 Species:Homo sapiens


Alignment Length:217 Identity:60/217 - (27%)
Similarity:89/217 - (41%) Gaps:45/217 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VVLHDFTPCVDDELEVKRGQLVNILYRENDWVYVIGQDSRQEGFIPFS---------YCAPCNTQ 118
            |.|:.|.....|||...:|..:.||..|:|..:...:....|||||.:         |....:.|
Human     4 VALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGVEGFIPKNYIRVKPHPWYSGRISRQ 68

  Fly   119 LADLAVKKK------LPREQCPEQPIE-----------ENIPLLGTDNKLDVLCDETLNPGSANS 166
            ||:..:.|:      |.||. ...|.|           ::..:|...:....|.:|..|  |.|.
Human    69 LAEEILMKRNHLGAFLIRES-ESSPGEFSVSVNYGDQVQHFKVLREASGKYFLWEEKFN--SLNE 130

  Fly   167 I-----------ENTLLVEPECTPFVKEPSGRCI--VLYTFIARDENDLSVERGEFVTVLNREDP 218
            :           :..:.:..| .|.:|.| |.|.  ..:.|.|:|.:.||..||:.:.||.|.||
Human   131 LVDFYRTTTIAKKRQIFLRDE-EPLLKSP-GACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPDP 193

  Fly   219 DWFWIMRSDGQEGFVPASFIYP 240
            .| |..||.|:.||.|.|::.|
Human   194 HW-WRGRSCGRVGFFPRSYVQP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 16/56 (29%)
SH3 184..238 CDD:214620 24/55 (44%)
SH3 293..346 CDD:212690
GRAPNP_006604.1 SH3_GRAP_N 2..55 CDD:212881 16/50 (32%)
SH2_Grb2_like 56..150 CDD:199828 16/96 (17%)
SH3_GRAP_C 162..214 CDD:212884 21/52 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.