DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and sh3rf2

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_009289332.1 Gene:sh3rf2 / 100537944 ZFINID:ZDB-GENE-141212-301 Length:769 Species:Danio rerio


Alignment Length:369 Identity:79/369 - (21%)
Similarity:119/369 - (32%) Gaps:130/369 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LHDFTPCVDDELEVKRGQLVNILYREND-WVYVIGQDSRQEGFIPFSYCAPCNTQLADLAVKKKL 128
            |:||......||.:|.|.::.:.:|.:| |.|..|:|||  |.:|.:.          |.|..:.
Zfish   125 LYDFQGNAPGELTMKSGDIIYLRWRVDDNWYYGEGKDSR--GLVPVNV----------LQVLSEQ 177

  Fly   129 PREQCPEQPIEENIPLLGTDNKLDVLCDETLNPGSANSIENTLLVEP----ECTPFVKEPSGRCI 189
            |      ||:              .|| ..|...:||::      :|    ||..|.|   |..|
Zfish   178 P------QPL--------------ALC-RALYDFNANNL------DPEGSKECLTFFK---GDSI 212

  Fly   190 VLYTFIARD--ENDLSVERGEFVTVLNREDPDWFWIMRSDGQEGFVPASFIYPADSVRV------ 246
            .|...:..:  |..|..:.|.|...|...:|..:.::....:...|.|.   |..||||      
Zfish   213 TLLKQVNENWVEGKLGDKVGIFPLQLTEPNPAAYELLEKHKRRDSVEAQ---PRSSVRVNADACI 274

  Fly   247 ---------LQQQKATLNAMETI----LQQGQQ------GQQSQQQQQPQLG-LGTDDLRYHGTE 291
                     ...:.:.:|.:.::    |...||      ..|....:.|||. .....||.....
Zfish   275 HRRLTGPSQKSSRPSNVNLLNSLNCPPLSLSQQPPHISSSAQPSYSKTPQLATFNRPRLRSSRRN 339

  Fly   292 L--------------------------------------------VMLYDYKAQAPDDLYLSVRR 312
            |                                            ..||.|.....::|.|  |:
Zfish   340 LPKRHRTMNGESPPAITMALINPQASPMPSESKMSATQQLSISVCAALYSYTPYRSEELEL--RK 402

  Fly   313 GDW--IYADLTNQTVDGWLWAYAPKTRKYGFIPKAYARPPAMTS 354
            |:.  :|...:    :|||...:.||.|.|.:|..|..|...||
Zfish   403 GEMVGVYGKFS----EGWLRGLSLKTGKVGILPTNYVTPVLRTS 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 17/46 (37%)
SH3 184..238 CDD:214620 11/55 (20%)
SH3 293..346 CDD:212690 16/54 (30%)
sh3rf2XP_009289332.1 RING_Ubox 8..54 CDD:327409
SH3 122..173 CDD:327375 18/59 (31%)
SH3 183..237 CDD:327375 17/63 (27%)
SH3 384..437 CDD:327375 17/58 (29%)
SH3 710..763 CDD:327375
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583881
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.