DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and arhgef38

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_009289887.1 Gene:arhgef38 / 100317614 ZFINID:ZDB-GENE-090313-83 Length:762 Species:Danio rerio


Alignment Length:285 Identity:56/285 - (19%)
Similarity:112/285 - (39%) Gaps:80/285 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCPVRMRRDKKKATNASIERDLPAVGVLGMGRITGSSSIETLVRVGIEKEHG------------- 55
            :|.|::.|....|....::: || |.:.....:. :|.:|.|..:|..||:.             
Zfish   502 ICIVKLIRKLMDAAQPPVQQ-LP-VPLSNFNEVQ-NSIMEELSNLGFFKENSQKLMERKVSFEKR 563

  Fly    56 ---LSP-------DSKMVVLHDF------------TPCVDDELEVKRGQLVNILYRENDWVYVIG 98
               ::|       :.:..:|.::            ..|.:.::.:..|:||.:| .:.|   .:|
Zfish   564 EKKMAPEILRQTEEQRARLLEEYPVKQLYQLKRNCNACQEKDISLLEGELVALL-EDRD---PMG 624

  Fly    99 QDSR-------QEGFIPFSYCAPCNTQLADLAVKKKLPREQCPEQPIE-ENIPLLGTDNKLDVLC 155
            ..||       .:|::..|:....|            |:.:..|:|.: :|:.|..:.::     
Zfish   625 SSSRWLVHTGSVQGYVYSSFLKAYN------------PQREVTERPDDFDNLSLFVSASR----- 672

  Fly   156 DETLNPGSANSIENTLLVEPECTP---FVKEPSGRCIVLYTFIARDENDLSVERGEFVTVLNRED 217
                 ..|..|...:..|.|:..|   ...........:|.|.||.|.:|:::..:.|.:|...|
Zfish   673 -----SSSMRSFSTSDSVSPQSAPQDELDTSDDQHFYAVYAFKARCEQELTLQEYQHVRILQFSD 732

  Fly   218 ----PDWFWIMRSDGQEGFVPASFI 238
                .|| |:..|:||:|:|||:::
Zfish   733 LGGNKDW-WLAESNGQKGYVPANYL 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 11/68 (16%)
SH3 184..238 CDD:214620 19/57 (33%)
SH3 293..346 CDD:212690
arhgef38XP_009289887.1 RhoGEF 107..291 CDD:279015
BAR_DNMBP 343..524 CDD:153273 6/23 (26%)
SH3 591..646 CDD:302595 11/58 (19%)
SH3_DNMBP_C2 703..758 CDD:213017 19/55 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.