DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and sh3gl1a

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_005168475.1 Gene:sh3gl1a / 100005753 ZFINID:ZDB-GENE-030131-4524 Length:366 Species:Danio rerio


Alignment Length:293 Identity:59/293 - (20%)
Similarity:100/293 - (34%) Gaps:88/293 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CPVRMRRDKKKATN---ASIERDLPAVGVLGMGRITGSSSIETLVRVGIEKEHGLSPDSKMVVLH 66
            |.::..||..:.||   |.:|          ||        |.:.|:. |.:..|..|.|...:.
Zfish    96 CMLKYGRDMGEDTNFGGALVE----------MG--------EAMKRLA-EVKDSLDIDVKQNFID 141

  Fly    67 DFTPCVDDELEVKRGQLVNILYRENDWVYVIGQDSRQEGFIP----------------------- 108
            .|...||.:|:..:..|..:..|..|:.|    ..:::|.|.                       
Zfish   142 PFQTIVDKDLKDIQHHLKKLEGRRLDYDY----KKKRQGKIADEELRMAMEKFEESRDAAETSMQ 202

  Fly   109 ----------FSYCAPCNTQ----------LADL--AVKKKLPREQCPEQPIEENIPLLGTDNKL 151
                      ...||...:|          |.:|  |:::::.:.|  .||.::.:|:  :...:
Zfish   203 NLLDTDVEQVSQLCALVESQLQFHKQSMQVLEELAGAMRERVNKAQ--SQPRQKRMPV--SRPSI 263

  Fly   152 DVLCDETLNPGSANSIENTLLVEPECTPFVKEPSGR----------CIVLYTFIARDENDLSVER 206
            |....|..|.|...|............|.....|.|          |..||.|...:|.:|....
Zfish   264 DYSDPEDSNGGWNPSAAAPPSYSSTAAPSFNRASSRQKRNSADQPCCRALYDFEPENEGELGFNE 328

  Fly   207 GEFVTVLNREDPDWF-WIMRSDGQEGFVPASFI 238
            |:.:|:.|:.|.:|: ...|  ||.|..|.:::
Zfish   329 GDVITLTNQIDDNWYEGSFR--GQTGLFPCNYV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 11/82 (13%)
SH3 184..238 CDD:214620 18/64 (28%)
SH3 293..346 CDD:212690
sh3gl1aXP_005168475.1 BAR_Endophilin_A 25..247 CDD:153276 31/173 (18%)
SH3_Endophilin_A 308..362 CDD:212737 16/54 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583882
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.