DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlish and nphp1

DIOPT Version :9

Sequence 1:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001070638.1 Gene:nphp1 / 100002391 ZFINID:ZDB-GENE-060929-1234 Length:667 Species:Danio rerio


Alignment Length:272 Identity:58/272 - (21%)
Similarity:106/272 - (38%) Gaps:78/272 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 KRGQLVNILYRENDWV-----YVIGQDSR---QEGFIPFSYCAPCNTQLADLAVK-KKLPR---- 130
            :||.| .|:.||.|.:     .::.|.::   .|.......|......:.|:..: |||.:    
Zfish     5 RRGPL-QIVQRETDDIKRQVDALVQQAAKADVSENKEALQRCRELQRLVDDIMKRLKKLSKADEP 68

  Fly   131 ------EQCPEQPIEENIPLLGTDNKLDVLC------DETLNPGSANSIENTLLVEPE------- 176
                  :||..   ||...||...:.|..|.      |||..|.|:::.:::   |.|       
Zfish    69 APVGNYDQCKR---EEEKRLLTLHDHLQSLALQLLPHDETAGPSSSHTEQDS---EEEDSDEEDE 127

  Fly   177 --------------------------CTPFVKEPSGRCIVLYTFIARDENDLSVERGEFVTVLNR 215
                                      .....::.|...|.|.:|.|::|.|||:::||.:.||::
Zfish   128 SSEEEDAKGDVHEEDDDADSADEDTDMAAAAEQGSASYITLSSFTAKEEGDLSIQKGEILKVLSK 192

  Fly   216 EDPDWFWIMRSDGQEGFVPASFIYPADSVRVLQQQKATLNAMETILQQGQQGQQSQQQQQPQLGL 280
            ....|:....|:||:|.||.:|:..:.|   ||..:          ::.:..:.|:::|:.....
Zfish   193 NKDGWWLAQNSNGQKGLVPKTFLKMSSS---LQDSE----------RENEDEEDSEEEQESSKTS 244

  Fly   281 GTDDLRYHGTEL 292
            ..:.:|...||:
Zfish   245 NWNTVRKAVTEI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DlishNP_611251.2 SH3 61..111 CDD:212690 9/39 (23%)
SH3 184..238 CDD:214620 20/53 (38%)
SH3 293..346 CDD:212690 58/272 (21%)
nphp1NP_001070638.1 SH3_Nephrocystin 164..217 CDD:212704 20/52 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15176
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.