DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgBbeta and LPIN2

DIOPT Version :10

Sequence 1:NP_611248.3 Gene:rdgBbeta / 37011 FlyBaseID:FBgn0027872 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_005258234.1 Gene:LPIN2 / 9663 HGNCID:14450 Length:933 Species:Homo sapiens


Alignment Length:47 Identity:14/47 - (29%)
Similarity:20/47 - (42%) Gaps:6/47 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ARHSLEQSEEGEGVEVVENKPCEDPV------HGKGQYTEKHIHLSS 67
            ||.:...|...||.:.:|.....||:      ||.....:|.:.|||
Human   634 ARPAENDSSSDEGSQELEESITVDPIPTEPLSHGSTTSYKKSLRLSS 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgBbetaNP_611248.3 SRPBCC 3..252 CDD:472699 14/47 (30%)
LPIN2XP_005258234.1 Lipin_N 38..144 CDD:461356
Lipin_mid 506..598 CDD:465292
LNS2 674..899 CDD:462403 4/7 (57%)
WRNPLPNID 912..>930 CDD:464448
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.