DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgBbeta and PITPNM3

DIOPT Version :10

Sequence 1:NP_611248.3 Gene:rdgBbeta / 37011 FlyBaseID:FBgn0027872 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_112497.2 Gene:PITPNM3 / 83394 HGNCID:21043 Length:974 Species:Homo sapiens


Alignment Length:66 Identity:15/66 - (22%)
Similarity:27/66 - (40%) Gaps:17/66 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EYTCSF-----IPKLNVLIKTKYED-----------NNGSTENCLDLTEDELKVRTVDHLDIAFD 145
            |..||.     :.|.|:.|.:..||           ::.||.:|..:|:....:.:: |..:..|
Human   307 EEDCSLASSKRLSKSNIDISSGLEDEEPKRPLPRKQSDSSTYDCEAITQHHAFLSSI-HSSVLKD 370

  Fly   146 E 146
            |
Human   371 E 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgBbetaNP_611248.3 SRPBCC 3..252 CDD:472699 15/66 (23%)
PITPNM3NP_112497.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..304
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 323..346 3/22 (14%)
DDHD 390..593 CDD:460725
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 491..536
LNS2 739..869 CDD:197870
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 927..974
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.