DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgBbeta and PITPNC1

DIOPT Version :10

Sequence 1:NP_611248.3 Gene:rdgBbeta / 37011 FlyBaseID:FBgn0027872 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_036549.2 Gene:PITPNC1 / 26207 HGNCID:21045 Length:332 Species:Homo sapiens


Alignment Length:250 Identity:155/250 - (62%)
Similarity:204/250 - (81%) Gaps:1/250 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VLIKEYRVCMPLTVEEYKIGQLYMIARHSLEQSEEGEGVEVVENKPCEDPVHGKGQYTEKHIHLS 66
            :|:||||:||||||:||||||||||::||.|||:.|||||||:|:|.|||.||.||:|||.::|:
Human     1 MLLKEYRICMPLTVDEYKIGQLYMISKHSHEQSDRGEGVEVVQNEPFEDPHHGNGQFTEKRVYLN 65

  Fly    67 SRLPYWIQAICPRVFYVIEKSWNYYPYTLTEYTCSFIPKLNVLIKTKYEDNNGSTENCLDLTEDE 131
            |:||.|.:|:.|::|||.||:|||||||:|||||||:||.::.|:||||||.||.:...|....:
Human    66 SKLPSWARAVVPKIFYVTEKAWNYYPYTITEYTCSFLPKFSIHIETKYEDNKGSNDTIFDNEAKD 130

  Fly   132 LKVRTVDHLDIAFDEVSAKHYKKEEDPKFFKSEKTNRGPLIEGWRETDKPIMCSYKVVHASFEVW 196
            :: |.|..:|||.||:..::||:.||||.||||||.||.|.||||::.:|||||||:|...||||
Human   131 VE-REVCFIDIACDEIPERYYKESEDPKHFKSEKTGRGQLREGWRDSHQPIMCSYKLVTVKFEVW 194

  Fly   197 GLQTKVEDFIQRGIREILLLGHRQAFAWVDEWHGMTLEDVRAYERQKQAETNEKI 251
            ||||:||.|:.:.:|:|||:||||||||||||:.||:::||.:||..|..||:||
Human   195 GLQTRVEQFVHKVVRDILLIGHRQAFAWVDEWYDMTMDEVREFERATQEATNKKI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgBbetaNP_611248.3 SRPBCC 3..252 CDD:472699 154/248 (62%)
PITPNC1NP_036549.2 SRPBCC_PITPNC1_like 2..250 CDD:176899 154/248 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..332
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.