DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgBbeta and LPIN1

DIOPT Version :10

Sequence 1:NP_611248.3 Gene:rdgBbeta / 37011 FlyBaseID:FBgn0027872 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001248357.1 Gene:LPIN1 / 23175 HGNCID:13345 Length:975 Species:Homo sapiens


Alignment Length:137 Identity:31/137 - (22%)
Similarity:47/137 - (34%) Gaps:41/137 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 PKLNVLIKTKYEDNNGSTENCLDLTEDELKVRTVDHLDIAFDEVSAKHYKK------EEDPKFFK 162
            |:|::..:.|:|.::...|..      ..|.....||.: ...||   |||      |:    .|
Human   671 PQLSLATRVKHESSSSDEERA------AAKPSNAGHLPL-LPNVS---YKKTLRLTSEQ----LK 721

  Fly   163 SEKTNRGP---------------LIEG----WRETDKPIMCSYKVVHASFEVWG--LQTKVEDFI 206
            |.|...||               ..||    |...||.|:..........:..|  |.|..:|:.
Human   722 SLKLKNGPNDVVFSVTTQYQGTCRCEGTIYLWNWDDKVIISDIDGTITRSDTLGHILPTLGKDWT 786

  Fly   207 QRGIREI 213
            .:||.::
Human   787 HQGIAKL 793

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgBbetaNP_611248.3 SRPBCC 3..252 CDD:472699 31/137 (23%)
LPIN1NP_001248357.1 Lipin_N 50..156 CDD:461356
Lipin_mid 549..642 CDD:465292
LNS2 711..936 CDD:462403 19/87 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.