DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment swi2 and lrrc4ba

DIOPT Version :10

Sequence 1:NP_611247.3 Gene:swi2 / 37010 FlyBaseID:FBgn0034262 Length:499 Species:Drosophila melanogaster
Sequence 2:XP_021329717.1 Gene:lrrc4ba / 556747 ZFINID:ZDB-GENE-080327-25 Length:729 Species:Danio rerio


Alignment Length:397 Identity:80/397 - (20%)
Similarity:128/397 - (32%) Gaps:149/397 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 DFPEMLELHT--INISWTNLSYISSRTFKRVHPLKVLDLRWNQLIQLDGPLL--LPRNFEQLYLA 208
            :.|:.:..:|  :|:....:..|.|.|||.:..|::|.|..||:.|::....  || |...|.|.
Zfish    62 EVPDNISNNTRYLNLQENTIQVIKSDTFKHLRHLEILQLSKNQIRQIEVGAFNGLP-NLNTLELF 125

  Fly   209 GNPWNCTRNFKWLLLQPEKGRLVVDRDELICTDRKYKERQMLMVMHYKLELKRQCQSHEDLRNCT 273
            .|.         |.|.|.:                        ...|..:|:...     |||  
Zfish   126 DNR---------LTLVPSQ------------------------AFEYLSKLRELW-----LRN-- 150

  Fly   274 CLMHHILPKTHIPLYTVNCSHLQFHRLP-------------DFLPDNTTTLVINDNMIS-DINPL 324
                  .|...:|.|.       |||:|             |::.|.....:||...:: .:..|
Zfish   151 ------NPIETLPGYA-------FHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGL 202

  Fly   325 RDNPHYRHVV---DMQLENNQI-----SNVDNLED--TYW----------------LQNFRLLNL 363
            :|.|:...:|   :::|..|::     .:...||.  ..|                |:|...|||
Zfish   203 KDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSVIERNAFDDLKNLEELNL 267

  Fly   364 RGNNLRKLHVYALDNALDDNENANLLLLSRNPWHCTCKFGSRMRELLTKYKDIVRDAW------- 421
            ..|:|..| .:.|...|...|..:   |:.|||.|.|              |::..:|       
Zfish   268 SHNSLHSL-PHDLFTPLQKLERVH---LNHNPWVCNC--------------DVLWLSWWLKETVP 314

  Fly   422 -NVSCTYR--------------LDDDQLLAKV---------LTLSRQEMCNLSVEGGTQIHPIDW 462
             |.:|..|              ||........         |.::......|....||.:..::|
Zfish   315 SNTTCCARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNW 379

  Fly   463 L--NGVL 467
            :  ||.|
Zfish   380 ITPNGTL 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
swi2NP_611247.3 LRR <120..479 CDD:443914 80/397 (20%)
leucine-rich repeat 132..154 CDD:275378 1/5 (20%)
leucine-rich repeat 155..178 CDD:275378 7/24 (29%)
leucine-rich repeat 179..201 CDD:275378 8/23 (35%)
leucine-rich repeat 202..214 CDD:275378 3/11 (27%)
lrrc4baXP_021329717.1 LRR <70..>295 CDD:443914 59/282 (21%)
leucine-rich repeat 71..94 CDD:275380 7/22 (32%)
leucine-rich repeat 95..118 CDD:275380 8/23 (35%)
leucine-rich repeat 119..142 CDD:275380 7/55 (13%)
leucine-rich repeat 143..166 CDD:275380 10/42 (24%)
leucine-rich repeat 167..191 CDD:275380 2/23 (9%)
leucine-rich repeat 192..213 CDD:275380 3/20 (15%)
leucine-rich repeat 214..237 CDD:275380 3/22 (14%)
leucine-rich repeat 238..261 CDD:275380 2/22 (9%)
leucine-rich repeat 262..283 CDD:275380 7/21 (33%)
LRRCT 294..344 CDD:214507 12/63 (19%)
Ig 347..436 CDD:472250 8/40 (20%)
Ig strand B 364..368 CDD:409353 1/3 (33%)
Ig strand C 376..380 CDD:409353 0/3 (0%)
Ig strand E 402..406 CDD:409353
Ig strand F 416..421 CDD:409353
Ig strand G 429..432 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.