DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment swi2 and islr2

DIOPT Version :9

Sequence 1:	NP_611247.3	Gene:	swi2 / 37010	FlyBaseID:	FBgn0034262	Length:	499	Species:	Drosophila melanogaster
Sequence 2:	NP_001013541.1	Gene:	islr2 / 541396	ZFINID:	ZDB-GENE-050320-95	Length:	712	Species:	Danio rerio

Alignment Length:	179	Identity:	37/179 - (20%)
Similarity:	67/179 - (37%)	Gaps:	45/179 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly   290 VNCSHLQFHRLPDFLPDNTTTLVINDNMISDINPLRDNPHYRHVVDMQLENNQISNVD------- 347
            |:|::.....:|..||.|.:||.::.|.|..:.. :...:...|..:.|.:|:|..|:
Zfish    37 VDCAYKDLVEVPVGLPSNASTLSLSANKIKVLKS-KTFVNVTQVTSLWLAHNEIITVERDTLAPL 100

  Fly   348 ----NL------------EDTYWLQNFRLLNLRGN-----------NLRKLHVYALDN------- 378
                ||            ||...|...:||.:..|           ||:.|....::|
Zfish   101 IQLKNLDISNNKIVHFPWEDLANLGALQLLKMNNNEMVSIPKNAFSNLKDLRSIRINNNKFTTIV 165

  Fly   379 --ALDDNENANLLLLSRNPWHCTCKFGSRMRELLTKYKDIVRDAWNVSC 425
              ..|.....:.|.:..||:.|:|.. ..:|:.:.|....:.:..|::|
Zfish   166 QGTFDSLAAMSHLQIFHNPFICSCNL-EWLRDWILKSSISIPEQNNIAC 213

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
swi2	NP_611247.3	LRR	<117..384	CDD:227223	28/136 (21%)
		leucine-rich repeat	132..154	CDD:275378
		leucine-rich repeat	155..178	CDD:275378
		leucine-rich repeat	179..201	CDD:275378
		leucine-rich repeat	202..214	CDD:275378
		leucine-rich repeat	287..307	CDD:275378	5/16 (31%)
		leucine-rich repeat	308..332	CDD:275378	4/23 (17%)
		leucine-rich repeat	333..357	CDD:275378	10/46 (22%)
		leucine-rich repeat	358..385	CDD:275378	8/46 (17%)
		leucine-rich repeat	386..398	CDD:275378	3/11 (27%)
islr2	NP_001013541.1	leucine-rich repeat	35..53	CDD:275380	4/15 (27%)
		LRR_RI	<47..>184	CDD:238064	27/137 (20%)
		LRR_8	53..113	CDD:290566	12/60 (20%)
		leucine-rich repeat	57..78	CDD:275380	4/21 (19%)
		leucine-rich repeat	79..102	CDD:275380	5/22 (23%)
		LRR_8	102..161	CDD:290566	12/58 (21%)
		leucine-rich repeat	103..126	CDD:275380	5/22 (23%)
		leucine-rich repeat	127..150	CDD:275380	5/22 (23%)
		leucine-rich repeat	151..174	CDD:275380	3/22 (14%)
		LRRCT	183..>221	CDD:214507	8/32 (25%)
		IG_like	252..345	CDD:214653
		Ig	256..345	CDD:299845
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24366
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.100