DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment swi2 and Lrt

DIOPT Version :9

Sequence 1:NP_611247.3 Gene:swi2 / 37010 FlyBaseID:FBgn0034262 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster


Alignment Length:426 Identity:88/426 - (20%)
Similarity:155/426 - (36%) Gaps:113/426 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AETISLFCMILIRLS--RAADDSHETSTLLATITTITTEIIPMPDSGRSCFGWSSAPEAAGGNCS 75
            |:.:.|..::.:.||  :.:..|..|...|..:..:......:.|..:|....|........:..
  Fly   265 ADFVGLTSLVYLELSNNQISSISQRTFVNLRKLEVLKLGGNRLGDYAQSLRSLSQCLSLRQLDLQ 329

  Fly    76 RSNRNGTL--KCYGGMNNLAALNQSGKLSR-VQPALEMLLCGWPKDGLNHFRDLQKLPRLRSLTI 137
            .:|.||.|  :...||.||.:||.:..|.: :|.                 :.|....||.||::
  Fly   330 ANNLNGPLSEQTLPGMRNLESLNLNRNLIKSIQN-----------------KALANFSRLVSLSL 377

  Fly   138 EYSGFTEFKFDFPEMLELH---------TINISWTNLSYISSRTFKRVHPLKVLDLRWNQLIQLD 193
            .::..        ::|:.|         ::::|:..:..|||.:.:.:..|.||||..|.|..|.
  Fly   378 RHNQI--------DVLQDHAFFGLGALDSLDLSYNGIVAISSASLQHLSRLTVLDLTHNFLRALT 434

  Fly   194 GPLLLP-RNFEQLYLAGNPWN-CTRNF-----KWLLLQPEKGRLVVDRDELICTDRKYKERQMLM 251
            ..|:.| .:..:|.||||..: ..||.     :...||.::..|..|     |:.|.:       
  Fly   435 SDLIAPLPSLRELRLAGNDISIVARNAMDGARELESLQMQENPLSCD-----CSIRPF------- 487

  Fly   252 VMHYKLELKRQCQSHEDLRNCTCLMHHIL---PKTHIPLYTVNCSHLQFHRLPDFLPDNTTTLVI 313
                 .|..::.|.|..| :.:|:....|   |...:|:.|::|.           .||..    
  Fly   488 -----AEWLQESQLHSSL-SASCVTPPRLEGAPLLQVPVETLSCD-----------MDNVE---- 531

  Fly   314 NDNMISDINPLRDNPHYRHVVDMQLENNQISNVDNLEDTYWLQNFR-----------LLNLRGNN 367
                       :||.:....::...:.||.|.:.:|.:...|....           ||||...:
  Fly   532 -----------KDNANIMQHLETLAKPNQTSPIKDLSEEIILHELHFSTDYGLILTWLLNLSKKD 585

  Fly   368 LR--KLHVYALDNALDDNENANLLLLSRNPWHCTCK 401
            ..  .:.||       ..|:.|.:|:..:|.||..|
  Fly   586 YMCDAIFVY-------KEEHINEILIDNSPIHCESK 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
swi2NP_611247.3 LRR <117..384 CDD:227223 59/298 (20%)
leucine-rich repeat 132..154 CDD:275378 3/21 (14%)
leucine-rich repeat 155..178 CDD:275378 5/31 (16%)
leucine-rich repeat 179..201 CDD:275378 10/22 (45%)
leucine-rich repeat 202..214 CDD:275378 5/12 (42%)
leucine-rich repeat 287..307 CDD:275378 2/19 (11%)
leucine-rich repeat 308..332 CDD:275378 2/23 (9%)
leucine-rich repeat 333..357 CDD:275378 5/23 (22%)
leucine-rich repeat 358..385 CDD:275378 6/39 (15%)
leucine-rich repeat 386..398 CDD:275378 3/11 (27%)
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064 11/68 (16%)
leucine-rich repeat 179..199 CDD:275378
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 225..248 CDD:275380
LRR_8 249..307 CDD:290566 7/41 (17%)
leucine-rich repeat 249..272 CDD:275380 2/6 (33%)
LRR_RI <270..479 CDD:238064 51/233 (22%)
leucine-rich repeat 273..296 CDD:275380 5/22 (23%)
leucine-rich repeat 297..322 CDD:275380 3/24 (13%)
LRR_8 322..382 CDD:290566 17/76 (22%)
leucine-rich repeat 323..347 CDD:275380 6/23 (26%)
leucine-rich repeat 348..371 CDD:275380 6/39 (15%)
LRR_8 370..428 CDD:290566 15/65 (23%)
leucine-rich repeat 372..395 CDD:275380 5/30 (17%)
leucine-rich repeat 396..419 CDD:275380 4/22 (18%)
LRR_8 418..478 CDD:290566 19/59 (32%)
leucine-rich repeat 420..443 CDD:275380 10/22 (45%)
leucine-rich repeat 444..467 CDD:275380 7/22 (32%)
LRRCT 476..526 CDD:214507 13/67 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.