DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment swi2 and ISLR

DIOPT Version :9

Sequence 1:NP_611247.3 Gene:swi2 / 37010 FlyBaseID:FBgn0034262 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_005536.1 Gene:ISLR / 3671 HGNCID:6133 Length:428 Species:Homo sapiens


Alignment Length:125 Identity:30/125 - (24%)
Similarity:53/125 - (42%) Gaps:17/125 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 LQKLPRLRSLTIEYSGFTEFKF-DFPEMLELHTINISWTNLSYISSRTFKRVHPLKVLDLRWNQL 189
            |..|..|:||.:.::..::|.: |...:..|..:.:....|::|....|:.:..|:.|.|..|:|
Human    94 LASLSHLKSLDLSHNLISDFAWSDLHNLSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRL 158

  Fly   190 IQL-DGPLLLPRNFEQLYLAGNPWNCTRNFKWL--------LLQPEKGRLVVDRDELICT 240
            ..| :|..........|.:..||::||....||        :..||       :|.:.||
Human   159 HTLAEGTFTPLTALSHLQINENPFDCTCGIVWLKTWALTTAVSIPE-------QDNIACT 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
swi2NP_611247.3 LRR <117..384 CDD:227223 30/125 (24%)
leucine-rich repeat 132..154 CDD:275378 5/22 (23%)
leucine-rich repeat 155..178 CDD:275378 4/22 (18%)
leucine-rich repeat 179..201 CDD:275378 7/22 (32%)
leucine-rich repeat 202..214 CDD:275378 3/11 (27%)
leucine-rich repeat 287..307 CDD:275378
leucine-rich repeat 308..332 CDD:275378
leucine-rich repeat 333..357 CDD:275378
leucine-rich repeat 358..385 CDD:275378
leucine-rich repeat 386..398 CDD:275378
ISLRNP_005536.1 leucine-rich repeat 32..51 CDD:275380
LRR_8 51..110 CDD:316378 5/15 (33%)
LRR 1 51..72
leucine-rich repeat 52..75 CDD:275380
LRR 2 75..96 1/1 (100%)
leucine-rich repeat 76..99 CDD:275380 2/4 (50%)
LRR_8 98..158 CDD:316378 13/59 (22%)
LRR 3 99..122 5/22 (23%)
leucine-rich repeat 100..123 CDD:275380 5/22 (23%)
LRR 4 123..144 4/20 (20%)
leucine-rich repeat 124..147 CDD:275380 4/22 (18%)
LRR 5 147..168 7/20 (35%)
leucine-rich repeat 148..171 CDD:275380 7/22 (32%)
PCC 153..>227 CDD:188093 17/66 (26%)
I-set 239..340 CDD:333254
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.