DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment swi2 and CG16974

DIOPT Version :9

Sequence 1:NP_611247.3 Gene:swi2 / 37010 FlyBaseID:FBgn0034262 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001246018.1 Gene:CG16974 / 34713 FlyBaseID:FBgn0032479 Length:1257 Species:Drosophila melanogaster


Alignment Length:515 Identity:104/515 - (20%)
Similarity:174/515 - (33%) Gaps:152/515 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 EIIPMPDSGRSCFGWS--------SAPEAAG---GNCSRSNRNGTLKCYGGMNNLAALNQSGKLS 102
            |.:.:.::...|..|:        ...|.:|   .|||             :.||..:.|..:|.
  Fly   206 ERLNLAENRLECLHWAIPLAVRRVKVLEMSGNRLSNCS-------------LLNLQYMKQLQELH 257

  Fly   103 RVQPALEMLLCGWPKDGLNHFRDLQKLPRLRSLTIEYSGFTEFKFD-FPEMLELHTINISWTNLS 166
            ..:..|..|    |:      |.|.:|..||.|.:..:..||...| |...|:|..:.:|...||
  Fly   258 LDRSELTYL----PQ------RFLGELSELRMLNLSQNLLTELPRDIFVGALKLERLYLSGNRLS 312

  Fly   167 YISSRTFKRVHPLKVLDLRWNQLIQLDGPLLLPRNF-------EQLYLAGNPWNCTRNFKWLLLQ 224
            .:....|:....|:||||..|:|      |..|.||       .||:|..|............|:
  Fly   313 VLPFMLFQTAADLQVLDLSDNRL------LSFPDNFFARNGQLRQLHLQRNQLKSIGKHSLYSLR 371

  Fly   225 PEKGRLVVDRDELICTDRK-YKERQMLMVMHYKLELKRQCQSHEDLRNCTCLMHHILPKTHIPLY 288
             |..:|.:.::.|...||| ::....|:.::.            ...|.|.|...|....| .|.
  Fly   372 -ELRQLDLSQNSLSVIDRKAFESLDHLLALNV------------SGNNLTLLSSIIFQSLH-ALR 422

  Fly   289 TVNCSHLQFHRLPDFLPDNTTTLVI----------NDNMISDINPLRDNPHYRHVVD-MQLENNQ 342
            .::.|..||.:||..|.....:||:          ..|.||..:....:|...|.:. :.::.|:
  Fly   423 QLDLSRNQFKQLPSGLFQRQRSLVLLRIDETPIEQFSNWISRYDESLVDPQVLHRLRYLSVQQNR 487

  Fly   343 ---------ISNVDNLEDTYWLQN--------------FRLLNLRGNNLRKLHVYALDNALDDNE 384
                     .:|..|:.:....:|              .:.|::|||:|.     :|...:.:..
  Fly   488 KLTYLPATLFANTPNIRELLLAENGLLQLPTQISGLSRLQRLSVRGNSLG-----SLPENIKELR 547

  Fly   385 NANLLLLSRNPWHCTCKF--------------------------GSRMRELLTKYKDIVRDAWNV 423
            ..:.|.:..|.:.|.|..                          ||..:..|..|:.|......:
  Fly   548 QLHYLNILGNEYQCDCSMYWLTAWLANTSTSLRHQMPQAQNHSNGSTNQTPLDSYESIDHQIDAL 612

  Fly   424 SCTYRLDDDQL--------------------LAKVLTLSRQEMCNLSVEGGTQIHPIDWL 463
            .|.|....|.|                    :.|:|:.::.| |.:|   |:.:..|.|:
  Fly   613 KCQYGYRGDMLRVLSKLNCSVPTVVQFSEPKMHKLLSTAKLE-CQIS---GSPVPDIIWV 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
swi2NP_611247.3 LRR <117..384 CDD:227223 68/309 (22%)
leucine-rich repeat 132..154 CDD:275378 7/22 (32%)
leucine-rich repeat 155..178 CDD:275378 5/22 (23%)
leucine-rich repeat 179..201 CDD:275378 9/21 (43%)
leucine-rich repeat 202..214 CDD:275378 5/18 (28%)
leucine-rich repeat 287..307 CDD:275378 7/19 (37%)
leucine-rich repeat 308..332 CDD:275378 6/33 (18%)
leucine-rich repeat 333..357 CDD:275378 3/33 (9%)
leucine-rich repeat 358..385 CDD:275378 6/26 (23%)
leucine-rich repeat 386..398 CDD:275378 2/11 (18%)
CG16974NP_001246018.1 leucine-rich repeat 206..228 CDD:275380 3/21 (14%)
leucine-rich repeat 229..252 CDD:275380 7/35 (20%)
LRR_RI <246..433 CDD:238064 55/216 (25%)
LRR_8 251..311 CDD:290566 18/69 (26%)
leucine-rich repeat 253..276 CDD:275380 7/32 (22%)
leucine-rich repeat 277..300 CDD:275380 7/22 (32%)
leucine-rich repeat 301..324 CDD:275380 5/22 (23%)
LRR_8 325..383 CDD:290566 18/64 (28%)
leucine-rich repeat 325..348 CDD:275380 11/28 (39%)
leucine-rich repeat 349..372 CDD:275380 5/23 (22%)
LRR_RI 351..>557 CDD:238064 42/224 (19%)
LRR_8 371..431 CDD:290566 14/73 (19%)
leucine-rich repeat 373..396 CDD:275380 5/22 (23%)
leucine-rich repeat 397..420 CDD:275380 6/35 (17%)
leucine-rich repeat 421..444 CDD:275380 7/22 (32%)
LRR_8 477..536 CDD:290566 8/58 (14%)
leucine-rich repeat 478..502 CDD:275380 2/23 (9%)
leucine-rich repeat 503..526 CDD:275380 1/22 (5%)
Ig <714..761 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.