Sequence 1: | NP_611247.3 | Gene: | swi2 / 37010 | FlyBaseID: | FBgn0034262 | Length: | 499 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001019782.1 | Gene: | LRRC66 / 339977 | HGNCID: | 34299 | Length: | 880 | Species: | Homo sapiens |
Alignment Length: | 178 | Identity: | 44/178 - (24%) |
---|---|---|---|
Similarity: | 71/178 - (39%) | Gaps: | 40/178 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 TLKCYGGMNNLAALNQSGKLSRVQPALEML--LCGWPKDGLNHFRD------------------- 125
Fly 126 --LQKLPRLRSLTIEYSGFTEFKF-DFPEMLELHTINISWTNLSYISSRTFKRVHPLKVLDLRWN 187
Fly 188 QLIQLDGPLLLPRNFEQLY--LAGNPWNCT------RNF-------KW 220 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24366 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |