Sequence 1: | NP_611247.3 | Gene: | swi2 / 37010 | FlyBaseID: | FBgn0034262 | Length: | 499 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006511267.1 | Gene: | Islr / 26968 | MGIID: | 1349645 | Length: | 436 | Species: | Mus musculus |
Alignment Length: | 253 | Identity: | 57/253 - (22%) |
---|---|---|---|
Similarity: | 90/253 - (35%) | Gaps: | 63/253 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 KAAETISLFC-MILIRLSRAADDSHETSTLLATITTITTEIIPMP-DSGRSCFGWSSAPEAAGGN 73
Fly 74 CSRSNRNG----------TLKCYGGMNNLAALNQSGKLSRVQPALEMLLCGWPKDGLNHFRD--- 125
Fly 126 --LQKLPRLRSLTIEYSGFTEFKF-DFPEMLELHTINISWTNLSYISSRTFKRVHPLKVLDLRWN 187
Fly 188 QLIQL-DGPLLLPRNFEQLYLAGNPWNCTRN---FK-WLLLQPEKGRLVVDRDELICT 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
swi2 | NP_611247.3 | LRR | <117..384 | CDD:227223 | 33/135 (24%) |
leucine-rich repeat | 132..154 | CDD:275378 | 6/22 (27%) | ||
leucine-rich repeat | 155..178 | CDD:275378 | 4/22 (18%) | ||
leucine-rich repeat | 179..201 | CDD:275378 | 7/22 (32%) | ||
leucine-rich repeat | 202..214 | CDD:275378 | 3/11 (27%) | ||
leucine-rich repeat | 287..307 | CDD:275378 | |||
leucine-rich repeat | 308..332 | CDD:275378 | |||
leucine-rich repeat | 333..357 | CDD:275378 | |||
leucine-rich repeat | 358..385 | CDD:275378 | |||
leucine-rich repeat | 386..398 | CDD:275378 | |||
Islr | XP_006511267.1 | leucine-rich repeat | 40..59 | CDD:275380 | 3/24 (13%) |
LRR_8 | 59..118 | CDD:338972 | 17/67 (25%) | ||
leucine-rich repeat | 60..83 | CDD:275380 | 6/26 (23%) | ||
leucine-rich repeat | 84..107 | CDD:275380 | 7/27 (26%) | ||
LRR_8 | 107..166 | CDD:338972 | 14/58 (24%) | ||
leucine-rich repeat | 108..131 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 132..155 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 156..179 | CDD:275380 | 7/22 (32%) | ||
PCC | 161..>235 | CDD:188093 | 17/62 (27%) | ||
Ig | 263..349 | CDD:319273 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24366 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |