DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema1b and sdf2l1

DIOPT Version :9

Sequence 1:NP_001163178.1 Gene:Sema1b / 37007 FlyBaseID:FBgn0016059 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001008033.1 Gene:sdf2l1 / 493395 XenbaseID:XB-GENE-970744 Length:218 Species:Xenopus tropicalis


Alignment Length:106 Identity:27/106 - (25%)
Similarity:46/106 - (43%) Gaps:25/106 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KILD--HNDEFVLVGAKDVIYNVSLNGLKEIARLEWHSTDADRELCALKGKHEWDCHNYLRVYAL 124
            |:|:  ||   |.:.:.||.|. |.:|.:.:..:|  ::|.......::||.:.||         
 Frog    39 KLLNSRHN---VRLHSHDVKYG-SGSGQQSVTGVE--ASDDANSYWRIRGKTDADC--------- 88

  Fly   125 RPNGEVLLCG-------TNSYKPRCRHYTPVEVSSEEAGSA 158
             ..||.:.||       .|:.|....|:.|..:|:.:..||
 Frog    89 -SRGEPIKCGQAVRLTHVNTGKNLHTHHFPSPLSNNQEVSA 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema1bNP_001163178.1 Sema_1A 55..511 CDD:200498 27/106 (25%)
PSI 510..>537 CDD:214655
sdf2l1NP_001008033.1 PMT1 <49..>209 CDD:224839 22/93 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.